KEGG   Sphingopyxis sp. PAMC25046: E5675_14395Help
Entry
E5675_14395       CDS       T06315                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sphx  Sphingopyxis sp. PAMC25046
Brite
KEGG Orthology (KO) [BR:sphx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    E5675_14395 (ahpF)
Enzymes [BR:sphx01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     E5675_14395 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like FAD_binding_3 AlaDh_PNT_C NAD_binding_7 Glutaredoxin K_oxygenase NAD_binding_8 Thi4 FMO-like DAO
Motif
Other DBs
NCBI-ProteinID: QCB55500
UniProt: A0A4P7RWE6
LinkDB All DBs
Position
3049193..3050755
Genome map
AA seq 520 aa AA seqDB search
MPMLDANTTAQLKTYLGNLRRPIELVASLDASPKSAEMRSLVEEVAAQSDLVTARFDGDD
ARRPSFAIRADEGRAEAVFAGLPMGHEFTSLILALLHVGGHPPKEDAELLGAARALEGDF
VFETFFSLSCQNCPDVVQALNIMAALNPNIRHTAIDGALFQEEVERRQVMAVPAVFLNGE
PFGQGRMDLAQIVAKLDTGAVARAAEKIGAKEPFDVLVVGGGPGGAAAAIYAARKGIRTG
IVAERFGGQVLDTLGIENFVSVQHTEGPKLAAQLEAHVKDYDVDVMNVQEAAELIPGGAH
GLHEVKLKSGASVKGKTVILSTGARWRQMGVPGEAEYRNKGVAYCTHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGLVAHVTLIEFDSQLRADAVLQTKLKSLPNVTVITSALTTEVLGN
GEKVVGLRYRDRNKDEEHLVELEGIFVQIGLIPNTEWLGNAVALSDRGEIEVDARGATSQ
PGIFAAGDVTTVPYKQIVIAMGEGSKASLSAFDHLIRSGA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgctcgacgccaacacgaccgcccagctcaaaacctatctcggcaacctccgt
cgcccgatcgagctggtcgcgagcctcgacgcctcacccaagtcggccgagatgcgcagc
cttgtcgaagaggtcgcggcgcagtcggacctcgtcaccgcgcgcttcgacggcgacgac
gcccgccgcccgtccttcgcgatccgcgccgatgagggtcgcgccgaagcggtgttcgcg
gggctgccgatggggcatgaattcacctcgctgatcctcgcgctgctccatgtcggcggc
catccgcccaaggaagacgccgagctgctcggcgcggcgcgcgcgctcgaaggcgacttc
gtcttcgaaaccttcttctcgctctcgtgccagaattgccccgacgtcgtgcaggcgctc
aacatcatggcggcgctcaatccgaatatccgccacacggcgatcgacggcgcgctgttt
caggaggaagtcgagcggcgtcaggtgatggctgttccggccgtcttcctgaacggcgaa
ccctttgggcagggccgcatggacctcgcgcagatcgttgcgaagctcgacaccggcgcg
gtcgcgcgcgcggccgaaaagatcggcgcgaaggagccgttcgacgtgctcgtcgtcggc
ggcggccccggcggcgccgcggcggcgatctatgccgcgcgcaagggcatccgcaccggc
atcgtcgccgaacgcttcggcgggcaggtgctcgacacgctggggatcgagaatttcgtc
tcggtccagcacaccgaggggccgaagctcgcggcgcagctcgaggcgcatgtgaaggac
tatgacgtcgacgtcatgaacgtgcaggaagccgccgagctgatcccgggcggcgcgcac
ggcctgcacgaagtgaagctcaagagcggcgcgagcgtgaagggcaagacggtgatcctg
tcgaccggcgcgcgctggcgccagatgggcgtccccggcgaggccgaatatcgcaacaag
ggcgtggcatactgcacgcactgcgacggtcccttgttcaagggcaagcgcgtcgcggtg
atcggcggcggcaattcgggcgtcgaggcggcgatcgacctcgccgggctcgtcgcgcat
gtgacgctgatcgagttcgacagccagcttcgcgccgacgcggtgctgcagaccaagctc
aagagcctgcccaacgtcacggtcatcacctcggcgctcaccaccgaagtgctcggcaat
ggcgagaaggtcgtcggcctgcgctatcgcgaccgcaacaaggacgaggagcatctggtc
gaactcgaaggcatcttcgtccagatcggcctcatcccgaacaccgaatggctcggcaat
gcggtggcgctcagcgatcgcggcgagatcgaggtcgatgcgcgcggcgcgacgagccag
cccggcatattcgccgcgggcgatgtgacgactgtgccctacaagcagatcgtcatcgca
atgggcgaaggctcaaaggcatcgctctcggccttcgatcacctgatccggtcgggcgcc
tga

DBGET integrated database retrieval system