KEGG   Sphingorhabdus sp. YGSMI21: CHN51_01850Help
Entry
CHN51_01850       CDS       T05308                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sphy  Sphingorhabdus sp. YGSMI21
Brite
KEGG Orthology (KO) [BR:sphy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CHN51_01850
Enzymes [BR:sphy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CHN51_01850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO FAD_oxidored FAD_binding_3 K_oxygenase Thi4 AlaDh_PNT_C Glutaredoxin NAD_binding_9 NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: ATW02407
UniProt: A0A2D3RAY8
LinkDB All DBs
Position
400912..402477
Genome map
AA seq 521 aa AA seqDB search
MPIIDQSTADQLKAYLVNLRRPIRLVATLDDSAKSAEMKELLETIAPMSDLVEVDLNGKS
KRVPSFLISADDGKSEVEFAGLPLGHEFSSLILGLLHVGGHPPKEDEELLESVASLEGEY
HFETFFSLSCQNCPDVIQALNIMAARNPNVSHVAIDGALFQDEVEERKVMAVPTVFLNGE
PFGSGRMNLAEIMAKVDTGSAEKAASKLSAKEPYDVLVVGGGPAGAAAAIYTARKGIRTA
IIAEQFGGQLMDTMGIENFISVPYTEGPKLTAELQRHVNEYDLEVFSQQRVADLARPAED
GDLFALTTESGGSLKAKAVILATGARWKTIGVPGEAEYRNKGVAYCPHCDGPLYKGKRVA
VIGGGNSGVEAAIDLAGIVSHVTLIEFDSAMRADAVLQKKMNSLPNVTAIVSAQTTEITG
DGEKVTGLRYKDRNSGEEHDVALEGVFVQIGLMPNSEWLGDVVKRSPYGEIEIDHRCETS
VPGIFAAGDVTTVPYKQIVISMGEGSKAALSAFDCLIRADG
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcatcgatcaatccaccgccgatcagctgaaagcctatctggtcaacctgcgc
cgcccgatccggctggtcgccactctggacgacagcgcgaaatcggccgagatgaaagaa
ttgctcgagacgatcgccccgatgtccgatcttgtagaagtcgatctcaacggaaaatcg
aagcgcgtgccatctttcctgatttctgcggacgatggcaaatcggaagtcgaatttgcc
ggactgccgctgggacacgaattttcctcgctcattctcggcttgctgcacgtcggcggc
catccgccgaaagaggatgaagagctgctcgaaagcgttgcatcgctggaaggcgaatat
catttcgaaacatttttctcgctctcctgccagaattgcccggacgtcattcaggcgctc
aatatcatggccgcccgcaaccccaatgtcagccatgtcgccatcgacggcgcgctgttt
caggacgaggtcgaggagcgcaaggtcatggcggtgccaaccgtctttctgaacggcgag
ccctttggttccgggcggatgaatctggccgagatcatggccaaggtcgataccggcagc
gccgagaaagcagccagcaaactgtcggccaaagaaccctatgacgtgctggtggtcggc
ggcgggcccgctggcgcggctgcggccatctacacggcgcgcaagggaatccgcaccgcc
atcatcgccgaacagttcggcggccagttgatggatacgatggggatcgagaatttcatc
tccgtgccctataccgaggggcccaagctcactgcggaattgcagcggcatgtgaacgaa
tatgatctggaagtgttcagccagcagcgcgtcgcggatctggcgcgcccggccgaggac
ggcgatctgtttgcgctcacgaccgagagcggcgggtcgctgaaagcgaaagcggtcatt
ctggcaaccggtgcgcggtggaagaccatcggcgtgcccggcgaagccgaatatcgcaac
aagggtgtcgcctattgcccgcattgcgacggcccgctttacaaaggcaagcgcgtcgcg
gttatcggcggcggcaattccggcgtggaagcggcgatcgatctggccggcattgtcagc
catgtcaccctgatcgagtttgacagcgcgatgcgcgccgatgccgtgctgcagaagaaa
atgaacagcctgcccaatgtcaccgccattgtttcggcgcaaacgaccgaaattacaggc
gacggcgagaaggttaccggcctgcgctacaaggatcgcaacagcggtgaagagcatgat
gtcgcgctggaaggtgtgtttgtccagattggcctgatgccgaacagcgaatggctgggc
gatgtggtcaagcgatccccttatggagagatcgagatcgaccatcgctgcgaaacctcc
gttccgggcatctttgccgcaggcgacgtaacgacagtgccttacaagcagatcgtcatc
tcgatgggtgaagggtcgaaagccgcgctgtccgcctttgactgtctcatccgggcggat
ggctag

DBGET integrated database retrieval system