KEGG   Sphingorhabdus sp. YGSMI21: CHN51_12000Help
Entry
CHN51_12000       CDS       T05308                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sphy  Sphingorhabdus sp. YGSMI21
Pathway
sphy00473  D-Alanine metabolism
sphy00550  Peptidoglycan biosynthesis
sphy01100  Metabolic pathways
sphy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sphy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CHN51_12000
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CHN51_12000
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CHN51_12000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sphy01011]
    CHN51_12000
Enzymes [BR:sphy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CHN51_12000
Peptidoglycan biosynthesis and degradation proteins [BR:sphy01011]
 Precursor biosynthesis
  Amino acid ligase
   CHN51_12000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ATW04167
UniProt: A0A2D3RG26
LinkDB All DBs
Position
2474954..2475886
Genome map
AA seq 310 aa AA seqDB search
MTANNEKSLHVAVLMGGWSAEREVSLSSGNGVADALEKNGHQVSRVDMDRNVAQVLAALR
PDVVFNALHGVPGEDGSVQGMLDLMQIPYTHSGMVTSVIAIDKELTKQQLVPAGIPMPKG
RIVSSASLYEADPLPRPYVLKPVNEGSSVGVAIVTDDSNYGNPIGRDVDGPWQEFDELLA
EPFIKGRELTTAVLGDKALCVTELRTAQGFYDYAAKYTEGLTQHVCPAEIPADIEKLCLD
YALRAHQVLGCKGTSRTDFRWDDEQGAAGLFVLETNTQPGMTPLSLVPEQAKQMGISYEE
LVEIIVREAL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgactgctaataatgaaaaaagtctccacgtcgctgtgcttatgggcggctggtctgct
gaacgcgaagtatcgctgagcagcggcaatggtgtggccgatgcgctggagaaaaacggc
catcaggtgagccgtgtcgacatggatcgcaatgttgcacaggtgctggccgctcttcgg
cctgatgtggtgttcaatgcgctgcacggcgtgccgggtgaagacggcagcgtccagggc
atgctcgacctgatgcagattccctatacccacagcggcatggtcacatcggtgatcgcg
atcgacaaggaattgaccaagcagcagctggttcccgccggtatcccgatgcccaagggc
cggattgtttccagtgccagcctgtatgaagccgatcccttgccgcggccctatgtcctg
aaaccggtcaacgaaggctcgtcggtcggcgtcgcaatcgtgaccgatgacagcaattac
ggcaatccgattggccgcgacgttgacgggccgtggcaggaatttgacgaactgctcgcc
gagcctttcatcaagggccgcgaactgaccaccgccgttctgggcgacaaggcgctttgc
gtgacagaactgagaaccgcgcagggtttctatgactatgctgccaaatataccgagggc
ctgacccagcatgtctgtcccgccgaaatccccgccgatatcgagaaattatgtctcgac
tatgccttgcgcgcccatcaagttctcggctgcaagggcacgtcgcgcaccgatttccgc
tgggatgacgaacagggtgcggccggtctgttcgtactggaaaccaatacccagccgggc
atgaccccgctcagtctggtccccgaacaggcaaagcagatggggatcagctatgaagag
ctggtcgagataatcgtgagagaagcgctatga

DBGET integrated database retrieval system