KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy0014Help
Entry
MGAS10750_Spy0014 CDS       T00356                                 

Definition
(GenBank) Amino acid permease
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Phage_holin_3_6
Motif
Other DBs
NCBI-ProteinID: ABF36964
UniProt: Q1J947
LinkDB All DBs
Position
15012..16472
Genome map
AA seq 486 aa AA seqDB search
MKFTIITNYDTLSRKSFTIEGDNMTIFRKKKKYSNKTEMQRHFKVIDLVFLGLGSMVGTG
IFTVTGIGAAKYAGPALTISIIISAITIGILALFYAEFASRMPSNGGAYSYVYATLGEFP
AWLVGWYIIMEFLTAISSVAVGWGSYLKGLLANYNIVLPNALNGTFNLKNGTYIDILPVL
VMFFVTGIVLMNSKLALRFNSFLVILKFSALALFIFVGIFFIDHNNWSHFAPYGVGQITG
GKTGIFAGASVMFFAFLGFESISMAVDEVKEPQKTIPKGIILSLIIVTALYIVVTTILTG
IVHYTKLNVPDAVAFALRNIRLYWAADYVSIVAILTLITVCISMTYALARTIYSISRDGL
LPKSLYTLTKKNKVPQNATLVTGLLAMICAGIFPLSSLAEFVNICTLAYLIILSGAIIKL
RRIEGEPKANEFKTPLVPFLPILAIIICLSFMSQYKAFTWIAFAIATIIGTLIYLAYGYT
HSIENK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttacaatcattactaactatgatacacttagtagaaaatcatttactatagaa
ggtgataacatgactatttttcgtaaaaaaaagaaatattccaataaaacagaaatgcaa
aggcacttcaaagttattgatttagtttttttaggcctaggttcaatggttggaacaggt
atctttacagttactggcataggcgctgctaagtatgcaggtcctgctttaacaatatcg
attatcatttccgcgattactattggaattttagccttattttatgcagaatttgcgtct
cgtatgccttctaacggtggtgcttatagttatgtttatgcaaccttgggagagtttcca
gcatggcttgttggctggtatattattatggaatttttaacagctatatctagtgttgct
gttggctggggaagttatttaaaaggattacttgccaattataatatagtattaccaaac
gctttaaatggcacgttcaatcttaagaatggaacttacatagatattcttcctgtttta
gtgatgtttttcgtgacagggattgtcctaatgaattcgaaattagctctgagattcaat
agttttttagttattttaaaattttcagcactggctttatttatctttgtaggcattttt
tttattgatcacaataattggtctcattttgctccatatggtgtaggacaaattactgga
ggtaaaacaggtatctttgctggtgcttctgttatgttctttgcatttttaggatttgaa
tctatttcaatggcagttgatgaagtgaaagaaccacaaaaaacaattcctaaaggtatc
attttatctttgattattgtaacagcactctatatagttgtcaccactattttaacggga
attgtacactacactaaattaaatgttccagacgcggtggcttttgctttaagaaatatt
agactttattgggcagctgactatgtgtcgatagttgctattttgactcttattacggta
tgtatttctatgacttatgcattagctagaacaatttacagtattagtagagatggttta
ttacctaaatcactttatactctcactaaaaaaaataaagtgcctcaaaatgctactctt
gtcactggactacttgctatgatttgtgcgggaatatttcctttatcgagtctagcagag
tttgttaatatttgtactttagcatatttaattattctgtcgggtgcaattattaaactc
agaagaatagaaggagaaccaaaagcaaatgaatttaaaactcctctagtaccattccta
ccaatattggcaattatcatttgtctatcatttatgagccaatataaagcttttacttgg
attgcttttgctattgccacaattattggaacattaatctacttagcttatggttatact
cattcaatagaaaataaataa

DBGET integrated database retrieval system