KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy0712Help
Entry
MGAS10750_Spy0712 CDS       T00356                                 

Gene name
aroF
Definition
(GenBank) Chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
spi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spi01100  Metabolic pathways
spi01110  Biosynthesis of secondary metabolites
spi01130  Biosynthesis of antibiotics
spi01230  Biosynthesis of amino acids
Module
spi_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:spi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MGAS10750_Spy0712 (aroF)
Enzymes [BR:spi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     MGAS10750_Spy0712 (aroF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-ProteinID: ABF37662
UniProt: Q1J7B2
LinkDB All DBs
Position
688582..689748
Genome map
AA seq 388 aa AA seqDB search
MRYLTAGESHGPSLTAIIEGIPAGLTLHPADIDHELQRRQGGYGRGARMSIETDRVQISS
GVRHGKTTGAPITLTVINKDHQKWLDVMAVGDIEETLKLKRRVKHPRPGHADLVGGIKYH
FNDLRDALERSSARETTMRVAVGAVAKRILAELGIDMLHHILIFGGITITIPSKLSFREL
QERALHSELSIVNPKQEEEIKTYIDKIKKEGDTIGGIIETIVQGVPAGLGSYVQWDKKLD
AKLAQAVLSINAFKGVEFGVGFDMGFQKGSQVMDEITWTPTQGYGRQTNHLGGFEGGMTT
GQPLVVKGVMKPIPTLYKPLMSVDIDSHEPYKATVERSDPTALPAAGVIMENVVATVLAK
EILETFSSTTMSELQKAFSDYRAYVKQF
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
ttgcgttatttaacagcaggagaatctcatgggccatccttaacagctattattgaaggt
ataccagcaggattaactcttcatccagcggatattgatcacgaattacagcgacgtcaa
ggaggttatggccgtggtgccagaatgtctattgagactgatcgggttcaaatatcctca
ggagttcgtcatggcaaaacaacaggggcccccattaccttaacggtaattaataaggac
caccaaaaatggctagatgtcatggctgtaggagacattgaagagactctcaagttaaag
cgtcgtgttaagcatcctagaccaggacatgcggatttggtaggaggtattaaatatcat
tttaacgatttaagagatgctttagagcgttcctcggctagagaaacaacgatgagagtg
gctgtaggcgctgttgctaaacgtatcttagctgaacttggaattgatatgttacatcat
atcttaatatttggtggtataacgatcacaataccttctaagctctcttttagagagttg
caagaaagggctctccattcagaattatctattgttaatccaaagcaagaagaagaaatt
aaaacgtatattgataagataaaaaaagaaggggatactattggtggtattatcgaaacg
atagttcaaggggtgccagcaggtcttggatcttatgtccaatgggataaaaaattagat
gccaagctggctcaagcagttctttccattaatgcttttaaaggggtggaatttggagtt
gggtttgatatgggattccaaaagggctctcaggtaatggatgaaatcacctggacacct
acccaaggctatggtcgtcaaacaaaccacttaggtggctttgaaggtggcatgaccaca
ggacaacctcttgttgttaaaggggttatgaagcccattcctactttgtataaaccactc
atgtcggtagatattgatagtcatgaaccttataaagcaacggtggaacgctctgatccg
acggccttaccagctgcaggggttatcatggaaaatgtggtggcgacggtgcttgccaaa
gagattttagagactttttcttctactaccatgtctgaattgcaaaaagctttttcggac
tatcgtgcctacgtcaagcaattttag

DBGET integrated database retrieval system