KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy0928Help
Entry
MGAS10750_Spy0928 CDS       T00356                                 

Definition
(GenBank) Collagen-like surface protein
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Collagen Gram_pos_anchor
Motif
Other DBs
NCBI-ProteinID: ABF37878
UniProt: Q1J6V5
LinkDB All DBs
Position
884501..885787
Genome map
AA seq 428 aa AA seqDB search
MNKTKQNKTKQNKTKQNKTKQSLLCRYGLTSAAALLLTFGGASAVKADAVGRQQVQDELQ
NQRKALPRLKEFYKDTPNSGVENTPIYKYLTEMEGKLNRYLETLDEGLHQLQGDKGEPGA
QGPAGPRGEQGPQGLPGKDGEAGAQGPAGPMGPAGERGEKGAQGPRGEQGPQGLPGKDGE
AGAQGPAGPMGPAGERGEKGAQGPRGEQGPQGLPGKDGEAGAQGPAGPMGPAGERGEKGE
PGTQGAKGDRGETGPAGPRGDKGEKGEQGPAGKDGERGPIGPAGKDGQNGKDGLPGKDGK
DGQNGKDGLPGKDGKDGQDGKDGLPGKPAPQTPEVPQKPDTAPHTPKTPQIPGQSKDVTP
APQNPSNRGLNKLQTQGGNQLAKTPAAHDTHRQLPATGETTNPFFTAAAVAIMTTAGVVA
VAKRQENN
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaaaacaaaacaaaacaaaacaaaacaaaacaaaacaaaacaaaacaaaacaaaa
caaagccttctttgtcgctatggcttaacctcagcagctgctcttttgctgacctttgga
ggtgcaagtgcagttaaggcggatgcagtaggaagacaacaagtgcaagatgaacttcaa
aatcagcgaaaagctttaccacgtcttaaagaattttataaggatactccaaactccggt
gttgaaaatactccgatttataagtatttaactgaaatggaagggaagttaaatcgttat
ctggagactttagacgaagggttgcaccagttgcaaggtgacaaaggagagcctggtgct
caaggcccagcaggtccacgtggtgaacaaggcccgcaaggtcttccaggtaaagatggt
gaagctggtgctcaaggcccagcaggtccaatgggtcctgctggtgagcgaggtgagaaa
ggagcccaaggtccacgtggtgaacaaggcccgcaaggtcttccaggtaaagatggtgaa
gctggtgctcaaggcccagcaggtccaatgggtcctgctggtgagcgaggtgagaaagga
gcccaaggtccacgtggtgaacaaggcccgcaaggtcttccaggtaaagatggtgaagct
ggtgctcaaggcccagcaggtccaatgggtcctgctggtgagcgaggtgaaaaaggagaa
cctggtacccaaggcgctaaaggtgatcgcggtgaaaccggcccagcaggcccacgtggt
gacaagggtgaaaaaggagaacaaggtcccgccggtaaagatggtgaacgtggtccaata
ggtccagctggtaaggacggccaaaacggcaaagatggtctcccaggtaaagacggcaag
gacggccaaaacggtaaagatggtctcccaggtaaagacggcaaggacggccaagatggc
aaagatggtcttccaggtaaaccggctcctcaaacaccagaggtccctcaaaaaccagat
actgcaccacatactccaaaaacccctcagatccctggccaatcaaaagacgtgacacct
gctcctcaaaacccttctaatagaggtctaaacaaactacaaacacaaggtggtaatcag
ctcgcaaaaacaccagcagctcacgacacacacagacaattgccagcaacaggcgaaaca
accaatccattctttacagcagctgctgtagctatcatgacgacagctggagttgtagct
gttgcaaaacgtcaagaaaacaactaa

DBGET integrated database retrieval system