KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy1444Help
Entry
MGAS10750_Spy1444 CDS       T00356                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Brite
KEGG Orthology (KO) [BR:spi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spi01001]
    MGAS10750_Spy1444
Enzymes [BR:spi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MGAS10750_Spy1444
Protein kinases [BR:spi01001]
 Serine/threonine kinases: Other
  Bacterial family
   MGAS10750_Spy1444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo RIO1 Kinase-like Haspin_kinase FTA2 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: ABF38394
UniProt: Q1J5J2
LinkDB All DBs
Position
complement(1377760..1379658)
Genome map
AA seq 632 aa AA seqDB search
MIQIGKLFAGRYRILKSIGRGGMADVYLANDLILDNEDVAIKVLRTNYQTDQVAVARFQR
EARAMAELNHPNIVAIRDIGEEDGQQFLVMEYVDGADLKRYIQNHAPLSNNEVVRIMEEV
LSAMTLAHQKGIVHRDLKPQNILLTKEGVVKVTDFGIAVAFAETSLTQTNSMLGSVHYLS
PEQARGSKATIQSDIYAMGIMLFEMLTGHIPYDGDSAVTIALQHFQKPLPSIIEENHNVP
QALENVVIRATAKKLSDRYGSTFEMSRDLMTALSYNRSRERKIIFEDVESTKPLPKVASG
PTASVKLSPPTPTVLTQESRLDQTNQTDALQPPTKKKKSGRFLGTLFKILFSFFIVGVAL
FTYLILTKPTSVKVPNVAGTSLKVAKQELYDVGLKVGKIRQIESDTVAEGNVVRTDPKAG
TAKRQGSSITLYVSIGNKGFDMENYKGLDYQEAMNSLIETYGVPKSKIKIERIVTNEYPE
NTVISQSPSAGDKFNPNGKSKITLSVAVSDTITMPMVTEYSYADAVNTLTALGIDASRIK
AYVPSSSSATGFVPIHSPSSKAIVSGQSPYYGTSLSLSDKGEISLYLYPEETHSSSSSSS
STSSSNSSSTNDSTAPGSNTELSPSETTSQTP
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgattcagattggcaaattatttgctggtcgttatcgcattctgaaatctattggccgc
ggtggtatggcggatgtttatttagcaaatgatttgatcttggataatgaagacgttgca
atcaaggtcttgcgtaccaattatcaaacagatcaggtagcagttgcgcgtttccaacgg
gaagcgcgggccatggctgaattgaaccatcccaatattgttgccatccgggatataggc
gaagaagacggacagcaatttttagtaatggaatatgtggatggtgctgacctaaagaga
tacattcaaaatcatgctccattatctaataatgaagtggttagaattatggaagaagtc
ctttctgctatgactttagcccaccaaaaaggaattgtacacagagatttaaaacctcaa
aatatcctactaactaaggagggggttgtcaaagtaactgatttcggcatcgcagtagcc
tttgcagaaacaagcttgacacaaactaattcgatgttaggcagtgttcattacttgtct
ccagaacaggctcgcggctccaaagcgacgattcaaagtgatatttatgcgatggggatt
atgctctttgagatgttgacaggccatatcccttatgatggcgatagtgctgttacgatt
gccttgcaacattttcaaaagcctcttccatctattatcgaggagaaccacaatgtgcca
caagctttggagaatgttgttattcgagcaacagccaagaaattaagtgatcgttacggg
tcaacctttgaaatgagtcgtgacttaatgacggcgcttagttataatcgtagtcgggag
cgtaagattatctttgaggatgttgaaagtaccaaacccctccccaaagtggcctcaggt
cccaccgcttctgtaaaattgtctccccctaccccaacagtgttaacacaggaaagtcga
ttagatcaaactaatcaaacagatgctttacagccccccaccaaaaagaaaaaaagtggt
cgttttttaggtactttattcaaaattcttttttctttctttattgtaggtgtagcactc
tttacttatcttatactaactaaaccaacttctgtgaaagttcctaatgtagcaggcact
agtcttaaagttgccaaacaagaactgtatgatgttgggctaaaagtgggtaaaatcagg
caaattgagagtgatacggttgctgagggaaatgtagttagaacagatcctaaagcagga
acagctaagaggcaaggctcaagcattacgctttatgtgtcaattggaaacaaaggtttt
gacatggaaaactacaaaggactagattatcaagaagctatgaatagtttgatagaaact
tatggtgttccaaaatcaaaaatcaaaattgagcgcattgtaactaatgaatatcctgaa
aatacagtcatcagtcaatcgccaagtgcgggtgataaatttaatccaaacggaaagtct
aaaattacgctcagtgttgctgttagtgatacgatcactatgcctatggtaacagaatat
agttatgcagatgcagtcaataccttaacagctttaggtatagatgcatctagaataaaa
gcttatgtgccaagctctagctcagcaacgggctttgtgccaattcattctcctagttct
aaagctattgtcagtggtcaatccccttactatggaacgtctttgagtctgtctgataaa
ggagagattagtctttacctttatccagaagaaacacactcttctagtagctcatcgagt
tcaacgtcaagttcaaacagttcttcaacaaatgatagtactgcaccaggtagcaacact
gaattaagcccatcagaaactacttctcaaacaccttaa

DBGET integrated database retrieval system