KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy1490Help
Entry
MGAS10750_Spy1490 CDS       T00356                                 

Gene name
glpF
Definition
(GenBank) Glycerol uptake facilitator protein
  KO
K02440  glycerol uptake facilitator protein
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Brite
KEGG Orthology (KO) [BR:spi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spi02000]
    MGAS10750_Spy1490 (glpF)
Transporters [BR:spi02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    MGAS10750_Spy1490 (glpF)
Ion channels [BR:spi04040]
 Non-ion channels
  Aquaglyceroporins or glycerol-uptake facilitators
   MGAS10750_Spy1490 (glpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: ABF38440
UniProt: Q1J5E6
LinkDB All DBs
Position
complement(1427955..1428656)
Genome map
AA seq 233 aa AA seqDB search
MDIFGEFLGTALLVLLGNGVVSGVVLPKTKTHASGWIVIATGWGIAVAVAVFISGKVAPA
HLNPAVSLAFAMSGTIAWSTAIAYSLAQLLGAMLGSTLVFLQFRPHYLAAESQADILGTF
ATGPAIRDTSSNLLSEIFGTFVLMLGILAFGLYDMPAGLGTLCVGTLVIGIGLSLGGTTG
YAINPARDLGPRLVHAILPLNNKGDSDWSYAWIPVVGPIIGAALAVLLFQVMS
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggatatctttggcgaatttttgggtacagccttattggttttactaggaaatggtgtg
gtatcaggggttgtcttgcccaaaacgaaaacccatgcttctggctggatcgtgattgcg
actggctggggaattgcagttgctgtggcagtctttatcagtggcaaagttgcccctgcc
cacctcaatccagctgttagccttgcttttgccatgagtggaaccattgcctggtcaaca
gccattgcctatagccttgcccaactattgggagctatgcttggttcaactctggtattc
cttcagttcaggccacattatctggctgctgagagtcaggctgatattttagggacattt
gcgacaggtcctgctattcgagataccagctcaaacctattgagtgaaatctttgggacc
tttgtcttgatgcttggtattttggcatttggcttatatgatatgccagcaggactaggg
accctctgtgtaggtaccttggttattgggattgggttatccttaggaggaacgacaggt
tacgccattaacccagcgcgtgatttaggacctcgtctagttcatgctattctaccactc
aacaacaagggagattctgattggtcttatgcttggatacctgttgtaggaccaattatt
ggagcggccttagcagttttgcttttccaagtcatgtcctaa

DBGET integrated database retrieval system