KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy1573Help
Entry
MGAS10750_Spy1573 CDS       T00356                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
spi00220  Arginine biosynthesis
spi00250  Alanine, aspartate and glutamate metabolism
spi00290  Valine, leucine and isoleucine biosynthesis
spi01100  Metabolic pathways
spi01110  Biosynthesis of secondary metabolites
spi01130  Biosynthesis of antibiotics
spi01210  2-Oxocarboxylic acid metabolism
spi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MGAS10750_Spy1573
   00290 Valine, leucine and isoleucine biosynthesis
    MGAS10750_Spy1573
   00220 Arginine biosynthesis
    MGAS10750_Spy1573
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spi01007]
    MGAS10750_Spy1573
Enzymes [BR:spi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MGAS10750_Spy1573
    2.6.1.66  valine---pyruvate transaminase
     MGAS10750_Spy1573
Amino acid related enzymes [BR:spi01007]
 Aminotransferase (transaminase)
  Class I
   MGAS10750_Spy1573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ABF38523
UniProt: Q1J563
LinkDB All DBs
Position
complement(1502121..1503371)
Genome map
AA seq 416 aa AA seqDB search
MVYNMEYEVYETMKIIEKSSKLEHVAYDIRGPVLDEANRMIASGEKILRLNTGNPAAFGF
EAPDEVIRDLIVNARLSEGYSDSKGIFSARKAIMQYCQLKGFPDVDIEDIYLGNGVSELI
SMSLQALLDNGDEVLVPMPDYPLWTACVSLGGGKAVHYLCNEEAGWYPDIADIKSKITSR
TKAIVVINPNNPTGALYPKEILEDIVALAREHQLIIFADEIYDRLVMDGKEHIAIASLAP
DVFCVSMNGLSKSHRIAGFRVGWMVLSGPKDHVKGYIEGLNMLANMRLCSNVLAQQVVQT
SLGGHQSVDALLLPGGRIFEQRNFIYEAINAIPGLSAVKPEAGLYLFPKIDRQMYRIDDD
EEFVLQLLKQEKVMLVHGRGFNWKDPDHFRIVYLPSVEELEDVQEKITRVLYQYRR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
ttggtttataatatggaatacgaggtgtatgagactatgaaaattattgaaaaatcatca
aaattagaacatgttgcctatgatattcgagggcctgttttggatgaagctaatcgcatg
attgcgagtggtgaaaaaattctgcgtttaaatactggcaatcctgctgcctttggtttt
gaagcaccagatgaagtgattcgtgatttaattgtcaacgcgaggctaagtgagggctat
tctgacagtaaagggattttttcagcgcgtaaggctatcatgcaatattgtcaactcaag
ggcttcccagatgttgacattgaagatatttatttgggaaatggcgtgtcagagttgata
tccatgtcccttcaagctttgctagataatggcgatgaagttttagtaccaatgccggat
tatcctttatggacggcttgtgtgagtcttggtggaggaaaagcggtccattatctttgt
aatgaagaagctggttggtatcctgatattgctgatatcaaatcaaaaatcacgagtcgc
accaaagctattgtggtcatcaatcctaataacccaacaggagctctttatcctaaggag
attttagaagacattgttgctttggcaagagaacaccagctgattatttttgccgatgaa
atctatgatcgtttggtgatggatggtaaagagcatattgctattgcaagtttggcacct
gatgttttttgtgtatctatgaatggcctttccaaatctcatcgtattgctggttttcgt
gttggatggatggtcttatcaggtcctaaagaccatgttaaaggttacattgaagggttg
aacatgcttgccaatatgcggttatgctccaatgttttagcccaacaagttgttcaaact
tccttaggaggccatcaatcagttgatgcactgttactgccaggagggcgtatttttgag
caacgtaattttatttatgaagctattaatgctatccctggcttatcggcagttaaacct
gaagcaggtctttatttatttccgaaaattgatcgtcagatgtatcgtattgatgatgat
gaagaatttgtcttacagttattaaagcaagaaaaagtgatgttggtacatggacgtggt
tttaactggaaagatccagatcacttccgtattgtttacctaccaagtgtagaagaatta
gaagatgtccaagaaaagattacacgtgtcttataccagtatagacgttaa

DBGET integrated database retrieval system