KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy1591Help
Entry
MGAS10750_Spy1591 CDS       T00356                                 

Gene name
acpS
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
spi00473  D-Alanine metabolism
spi01100  Metabolic pathways
spi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:spi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MGAS10750_Spy1591 (acpS)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    MGAS10750_Spy1591 (acpS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:spi01011]
    MGAS10750_Spy1591 (acpS)
Enzymes [BR:spi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MGAS10750_Spy1591 (acpS)
Peptidoglycan biosynthesis and degradation proteins [BR:spi01011]
 Precursor biosynthesis
  Racemase
   MGAS10750_Spy1591 (acpS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C TIG
Motif
Other DBs
NCBI-ProteinID: ABF38541
UniProt: Q1J545
LinkDB All DBs
Position
complement(1527029..1528129)
Genome map
AA seq 366 aa AA seqDB search
MISSFHRPTVARVNLQAIKENVASVQKHIPLGVKTYAVVKADAYGHGAVQVSKALLPQVD
GYCVSNLDEALQLRQAGIDKEILILGVLLPNELKLAITRQVTVTVASLEWLAMAKQEWPD
LKGLKVHIKIDSGMGRIGLRSVTEVDNLIAGLKSMGAEVEGIFTHFATADEADDTKFNQQ
LQFFKKLIAGLEDKPRLVHASNSATSIWHSDTIFNAVRLGIVSYGLNPSGSDLSLPFPLQ
EALSLESSLVHVKMISAGDTVGYGATYTAKKSEYVGTVPIGYADGWTRNMQGFSVLVDGQ
FCEIIGRVSMDQLTIRLPKAYPLGTKVTLIGSNQQKNISTTDIANYRNTINYEVLCLLSD
RIPRIY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaagtttccatcgcccaacagttgcaagggtcaacttacaagctattaaggag
aatgttgccagtgttcaaaagcatattccactaggggtaaaaacgtatgcagttgtcaag
gctgatgcttatggtcatggtgctgtccaggtgtcaaaagcactcctacctcaagtggat
gggtactgtgtgtcaaatcttgatgaggctttgcaattacgtcaagcaggtattgataaa
gagattttaattcttggggttttgctgccaaatgagctaaagttggcgattactcgccag
gttacagtgacagtggctagtttagagtggctggcgatggccaagcaagaatggccagat
ttgaaaggccttaaggtccatatcaaaattgattcaggcatgggacgaatcgggcttcgc
tcagtaacagaagttgataatctgattgctggcttgaagagcatgggggcagaagttgaa
gggattttcactcattttgccacagctgatgaggcagatgatactaaatttaaccagcag
ttacagttttttaaaaagctgatagctggacttgaggataagcctcgtttagtacatgct
agtaattcagccacaagtatctggcatagtgataccatttttaatgctgttcgtttagga
attgtcagttatggtttgaatccaagtggttctgatctaagcttaccatttccactgcaa
gaggctttatctctagaatctagcttagtgcatgtcaagatgatttcagctggtgataca
gtcggttatggagctacttatactgccaaaaagtctgaatatgtagggaccgtcccaatc
ggttatgcagatggctggaccaggaacatgcaaggcttttcggtgttagttgatggacaa
ttctgtgaaattatagggcgtgtatcgatggatcaactgaccatacgacttcccaaagca
tatcctttaggaacaaaagtcactttgattggcagcaatcagcaaaaaaatatttctaca
acagatatcgcaaattaccgtaatacaatcaattatgaagttctatgccttttaagtgac
cgtattcctcggatatattaa

DBGET integrated database retrieval system