KEGG   Spirosoma sp. KCTC 42546: EXU85_12380Help
Entry
EXU85_12380       CDS       T06164                                 

Definition
(GenBank) crotonase/enoyl-CoA hydratase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
spik  Spirosoma sp. KCTC 42546
Pathway
spik00071  Fatty acid degradation
spik00280  Valine, leucine and isoleucine degradation
spik00281  Geraniol degradation
spik00310  Lysine degradation
spik00360  Phenylalanine metabolism
spik00362  Benzoate degradation
spik00380  Tryptophan metabolism
spik00410  beta-Alanine metabolism
spik00627  Aminobenzoate degradation
spik00640  Propanoate metabolism
spik00650  Butanoate metabolism
spik00903  Limonene and pinene degradation
spik00930  Caprolactam degradation
spik01100  Metabolic pathways
spik01110  Biosynthesis of secondary metabolites
spik01120  Microbial metabolism in diverse environments
spik01130  Biosynthesis of antibiotics
spik01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:spik00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EXU85_12380
   00650 Butanoate metabolism
    EXU85_12380
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EXU85_12380
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EXU85_12380
   00310 Lysine degradation
    EXU85_12380
   00360 Phenylalanine metabolism
    EXU85_12380
   00380 Tryptophan metabolism
    EXU85_12380
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EXU85_12380
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EXU85_12380
   00281 Geraniol degradation
    EXU85_12380
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EXU85_12380
   00627 Aminobenzoate degradation
    EXU85_12380
   00930 Caprolactam degradation
    EXU85_12380
Enzymes [BR:spik01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EXU85_12380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: QDK79354
UniProt: A0A514ZXQ8
LinkDB All DBs
Position
3069936..3070775
Genome map
AA seq 279 aa AA seqDB search
MEQTYQSLSFAQADGVMTVSLLGPGKGNAMGPEFWEELPNAMDEINQLSDIRCIVFRGSG
DHFSYGLNIPQMMPRLGKMTTGTVLAQQRRELMGQIRQMQSGFQKMHESPKPVIAAIHGW
CIGGGVNMIAAADIRLCSREARFSLREAKLAITPDIGGLQFLPHIIGQGFTREMAFTGAD
YDAAFAERIGLVNHVYNSPDQLFDAAATLARQIADNPASAVQGAKQVLNYSLNKSIEDGL
QYVAVWNSSQLQSNDFSEAMQSTIEKRKAEFNKKSNRGY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaacctatcaatctttatcattcgcgcaggccgatggcgtgatgaccgtttcg
ctacttggccccggcaagggaaatgccatggggccggagttttgggaggagcttcccaac
gcaatggacgaaatcaatcagctttccgacattcgatgcattgtcttccggggaagtggt
gatcattttagctacgggcttaacatcccgcagatgatgcctcgcctggggaaaatgacc
acgggtactgtgctggcacaacagcgcagggaactaatgggacaaattcggcagatgcag
tcaggctttcagaaaatgcacgaatcgccaaagccagttattgcggccatacatggctgg
tgtattggcggtggcgtaaacatgattgctgctgccgatatccggctttgctcccgtgag
gccaggtttagcttacgggaagctaaacttgcgatcacccccgatattggcggtcttcag
tttttgccgcatatcattggtcagggatttacccgcgaaatggcgttcactggcgctgat
tacgatgctgcttttgctgagcgaattggtcttgtcaaccacgtttacaactctcccgac
caattatttgatgccgcagcaaccctggctcgacaaattgccgataatcccgcttcggct
gtacagggtgccaagcaagtactgaattacagcctgaacaaatccatcgaggatgggctt
caatacgtagccgtctggaattcaagtcaattgcaatccaatgatttctccgaagccatg
cagtcgacaatagagaaacgtaaagcagagtttaataaaaaatcaaatcgaggatattaa

DBGET integrated database retrieval system