KEGG   Spirosoma sp. KCTC 42546: EXU85_24775Help
Entry
EXU85_24775       CDS       T06164                                 

Definition
(GenBank) YihY/virulence factor BrkB family protein
  KO
K07058  membrane protein
Organism
spik  Spirosoma sp. KCTC 42546
Brite
KEGG Orthology (KO) [BR:spik00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    EXU85_24775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: QDK83837
UniProt: A0A515AAH9
LinkDB All DBs
Position
6008078..6008998
Genome map
AA seq 306 aa AA seqDB search
MKKVAPFFLLLKQAFTNLQANDPIRMAGATAFFSFFALPPIVIILSRVLSQLFNDHYQRI
SGQLFDELADLFGPKSANQLEAISHRLQLAKPSFPLTVLSSVLVLVASTTLFAIIKSSLN
QLWNIKKKSGRNLLLILIDKSVALAIILGSGFLFSLSLALEQLLVQLSTKWSLSSLTHYQ
DIANLGHILVSILIRMIWFGILFKFLPDVKISWRAVWTGALFTSILFKVGEAILNNLLIN
SQVGPLYGRSGAIILLLLFVFYASLIFYYGAAFTRQYSEWIHLAAKPNSRAIAYTITEVD
PSNPGV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaagtagcgcccttttttctgctcttaaaacaagcgtttacgaatttgcaggct
aatgatcccattaggatggctggtgcaactgcttttttttccttttttgctttaccacct
attgtaattatactcagtagggtccttagtcagctctttaatgatcactaccagcgtatt
agtggccagctatttgatgaattagccgacttgtttgggcctaaaagtgcgaatcaactg
gaagcgatttcgcaccgtcttcaactggctaaacctagtttcccattaacggtgctcagc
tctgtattagtgctggtagcctccaccaccttatttgccattattaaaagctccctcaat
caactttggaatatcaaaaagaaatctgggcgtaatctccttcttattctgatcgacaag
tcagttgctttagctattatactaggctcaggtttcttattcagcctctcgttagccttg
gagcaattgttagttcagcttagtacgaagtggtctctttcttcacttacccattatcag
gatatagccaatcttgggcatatattggtctctatcctcatccgcatgatttggtttggt
attctgtttaagtttttacccgatgttaaaatctcctggcgagctgtctggacaggtgcc
ttgttcactagtattctttttaaagtaggggaagccatactaaacaacctactgattaat
agccaggtaggtcctttatatggcagatcgggagcgatcattttactgttgctgtttgtt
ttctatgcctcactaattttctactatggggcagctttcacccgtcagtatagtgaatgg
attcatctggcagccaagcctaacagccgggccatagcctacacgattacggaagtggac
ccatcaaacccgggtgtataa

DBGET integrated database retrieval system