KEGG   Spirosoma sp. HA7: CWM47_03780Help
Entry
CWM47_03780       CDS       T05236                                 

Gene name
treS
Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
spir  Spirosoma sp. HA7
Pathway
spir00500  Starch and sucrose metabolism
spir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CWM47_03780 (treS)
Enzymes [BR:spir01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CWM47_03780 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CWM47_03780 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459
Motif
Other DBs
NCBI-ProteinID: AUD01018
UniProt: A0A2K8YTY5
LinkDB All DBs
Position
864120..867485
Genome map
AA seq 1121 aa AA seqDB search
MINNKQELPDNLYWYKDAIIYELHIKAFCDGNGDGIGDFQGLLEKLDYLQELGVTAIWLL
PFYPSPLRDDGYDIADYYKINSSYGTIDQFKTLLSEAHQRNLKVITELVINHTSDQHPWF
QRARKAPKGSPERDYYVWTDDPTQYKDVRIIFQDFENSNWTFDHQAQQYYWHRFFHHQPD
LNFDNPLVKSEIIKLIDFWCELGVDGFRLDAVPYLFEREGTNGENLPETHAFLKELRKHI
DDHFPGVAFLAEANMWPEDSASYFGEGDECHMNYHFPVMPRMFMALQMEDRYPITDIFDQ
TPAIPDNCQWAIFLRNHDELTLEMVTDEERDYMYKTYAKDPKAKINLGIRHRLAPLLDNN
RKKIELMNSLLFSLPGTPVIYYGDEIGMGDNVYLGDRDGVRTPMQWSPDRNAGFSKANPQ
KLYLPTILDPAYHYESVNVETQRANTSSLFWFMKRMINLRKRHKAFGRGDMKFLPVENPK
VLAFTRTYEDETLLIVVNLSKYAQPAEVELSDFKGYVPVEAFSKNSFPAVPDNESYFFTL
APHDYQWFVLEKVASTTVNPLSLPTLNVAIWSQLMNHGTRERLETKVLPDYLLKVDWFSE
KKRTMRSVSILNYATLPLTEESAYILLLEVSYEQGLPEIFQLIIAFASEPLATKLTNNCP
QSVLAKLEVSHQMGILCDGLYIPEIQQALLHQMASENTRSSGNLLFQRKPALSTYVQTHS
DIKSKLITDGNGYVSIVYDACYLLKLYRKVELSINPDTELTRFLSETAQYEYVPAFAGSI
ELLASGEPVMLGTMQVLVAKHGDGKSYVLDRVNNFIERILARDNSQLATAMAARRGTLSQ
PVAYSKLPVETQELLGSRAAEQARLLGIRVGQMHLAMASEKDLKDFAPEEFSLHYQRSLF
SGLQSLVRESYQSQKRNLQRLPSDIRQDVNQMLDRKDDVLTTLKRIYAKKLDATKIRIHG
DLQLEKILLTGKDIAIQDFGGDPSRSYSERRLKRSPLRDVASMIRSFHYVAHEGFLRNNQ
VSVDETTQLIPYAEFWAHYMSGFFVRAYLETVQNSSFIPKSTDDLQMMLETYLLEKAISD
LNYELNHRPDWVRVPLQMIKTIIAGQPTQEVLATYEAQPAS
NT seq 3366 nt NT seq  +upstreamnt  +downstreamnt
atgataaacaacaagcaggaattacccgataatctctattggtataaagatgccattatc
tatgaattacacatcaaagcgttttgcgatggaaatggcgacggaataggcgattttcag
ggattgcttgagaaattagattacctccaggaattaggcgttacggccatctggctatta
ccattttatccatcgcccctgcgcgatgacggctatgatattgccgattattataaaatc
aattcctcctacggaaccatcgaccagttcaaaaccctgctttccgaagcccaccagcgg
aatctgaaagtcattaccgaactggtcattaaccacacctccgatcagcatccgtggttt
caacgcgcccgaaaagcgcccaaaggatcgcccgaacgggattactatgtctggaccgat
gaccctacccaatacaaagacgttcggatcatctttcaggattttgaaaactccaactgg
acctttgatcatcaggcccagcagtactactggcaccgttttttccaccatcagcccgac
ctgaacttcgacaacccgctggtaaagagtgagataattaaacttattgatttctggtgc
gagttgggtgtcgatggtttccggctggatgccgtgccttacctgttcgaacgcgaaggc
actaacggtgaaaacctgcccgaaacacatgcctttctaaaagaactgcgtaaacacatc
gacgaccattttccgggcgtagccttcctggccgaagccaatatgtggcccgaagactcg
gcgtcctactttggtgagggagatgagtgccatatgaactaccattttccggtcatgccc
cgcatgtttatggccctgcaaatggaagaccggtatcctattaccgatatattcgatcag
acgcccgctattccggacaattgccaatgggccatttttcttagaaaccacgacgaacta
accctcgaaatggtgaccgacgaagagcgggactatatgtataaaacctatgccaaagac
cccaaagctaaaattaatctcggcattcggcaccggctggctccacttctggataacaat
cggaagaaaatagagcttatgaacagcctgctgttttcgctgccgggcactccggttatc
tactacggcgacgagattgggatgggcgacaatgtatatctgggcgatcgcgacggggtt
cgtacgcccatgcaatggtcgcccgatcgtaacgccgggttctccaaggcaaaccctcaa
aaactttatctgcccactattctcgacccggcctatcactatgaatcggtcaatgttgaa
acgcagcgggctaatacctcgtcgttgttctggttcatgaagcggatgattaatttgcgc
aaacggcacaaggcgtttgggcggggtgatatgaaatttctgcccgtcgaaaatcccaaa
gtgctggcgtttacccgtacctacgaggacgaaacgctgttgatcgtggtcaatctgtcg
aagtatgcacaaccggccgaggtggaattaagtgactttaaaggctatgttcctgtagag
gcatttagtaaaaattcgtttccggccgttcccgataacgaatcgtacttttttacgctg
gctccccatgattaccagtggtttgtgctggagaaggtcgcatcgacaacagtcaaccca
ttatcattgccaacgctcaacgtagctatctggagtcaattgatgaatcatggcacccgc
gaacgactggaaacaaaagtccttcccgattatttacttaaagtcgactggttcagcgag
aaaaaacgaaccatgcggagcgtgtcgattctgaattatgcgacactccccctgactgaa
gagtcggcttacattctcctgctggaggtgtcgtatgaacaggggttacctgaaattttc
cagttgatcatcgccttcgccagtgaaccactagccaccaaattaaccaataactgtccg
cagtcggtactggccaaactggaagttagtcaccagatgggaattctttgcgatggttta
tacatacctgaaattcagcaggcactgctccaccaaatggcaagtgaaaacacacgctca
agtggaaatctgctctttcagcgtaagcctgctctaagtacgtatgtgcagacacacagc
gatataaaatcgaaactgattaccgatggtaatggctatgtgtcaattgtttacgatgcc
tgttatctgttaaagctttaccgaaaggtagagctgtccatcaatcctgatactgaactc
acgcggttcctgtccgaaaccgcccagtatgaatacgtacctgcctttgccgggtctatt
gaactgttggcttccggcgagccggtcatgttaggtacgatgcaggtactggtggctaaa
catggcgatggtaaaagctacgtactggatcgagtcaacaattttatcgaacgaattctg
gcacgggacaatagccagctggcaacggctatggcggcccggcgcggtacgttaagccag
ccagttgcgtatagcaaactaccggtcgaaacgcaggaactgctgggaagccgggcggct
gaacaggctcggttattgggtattcgtgtagggcagatgcacctggctatggcctccgaa
aaggacctgaaggactttgcccctgaagaattttcccttcattatcaacgctccctgttt
tcaggcttacagtcgctggttcgtgaaagttatcagagccagaaacgaaacctgcaacgg
ctacccagtgacattcggcaggacgttaaccaaatgctggaccgcaaagacgatgtatta
acgacactcaaacggatctacgcgaaaaagttagatgctacgaaaatcaggattcacggg
gatttgcagctggaaaaaattctgctgacaggcaaagacattgccattcaggattttggt
ggtgaccctagtcgtagttatagcgaacggcgtttaaagcggtcgcccctgcgtgatgta
gcgtctatgatccgttcgtttcattacgtagctcacgaaggctttttgaggaataaccag
gtgtcagtcgatgaaaccacacaattgataccttatgctgaattctgggcgcactacatg
agtggtttttttgtccgggcttacctggaaacggttcagaatagctcatttattcccaaa
agtaccgacgatctgcaaatgatgctcgaaacgtatctgctcgaaaaagccatttccgat
ctgaattacgaactgaatcatcgccccgactgggtgcgcgtacccttgcagatgatcaag
acaatcattgccggtcagcctactcaagaggtactggctacctatgaagcccagcctgca
agctag

DBGET integrated database retrieval system