KEGG   Spirosoma pollinicola: CWM47_12070Help
Entry
CWM47_12070       CDS       T05236                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
spir  Spirosoma pollinicola
Pathway
spir00010  Glycolysis / Gluconeogenesis
spir00020  Citrate cycle (TCA cycle)
spir00620  Pyruvate metabolism
spir01100  Metabolic pathways
spir01110  Biosynthesis of secondary metabolites
spir01120  Microbial metabolism in diverse environments
spir01130  Biosynthesis of antibiotics
spir01200  Carbon metabolism
Module
spir_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:spir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CWM47_12070
   00020 Citrate cycle (TCA cycle)
    CWM47_12070
   00620 Pyruvate metabolism
    CWM47_12070
Enzymes [BR:spir01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CWM47_12070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 PYNP_C QRPTase_N HlyD_3 GCV_H HlyD_2
Motif
Other DBs
NCBI-ProteinID: AUD02498
UniProt: A0A2K8YY75
LinkDB All DBs
Position
complement(2872230..2874011)
Genome map
AA seq 593 aa AA seqDB search
MAELIRMPKMSDTMTEGVIAEWHKKVGDKVKSGDVLAEVETDKATMDLEAYDEGTLLYIG
VEKGASVPVDGVLAVIGADGEDYKALLNGTSGGSQSAEAPAAPKPEPAPAPANSASNETA
TKLPDPKAISAAPAENVNASIIRMPKMSDTMTEGTIVAWHKKEGDTVKSGDVLAEVETDK
ATMDLEAYEEGTLLYIGVKEGSSVAVDEIIAVVGEKGANFKVLLDGGGGAPAAGNEAATG
EGGSATAQQNPQADLPADADTDLSYGGGEGDVVGSNGRVKASPLAKRIAEEKGINLTQVH
GSGPEGRIVKSDVESFVPGKTAPAKAAPAAQPAAPAPQPTAPAAQSAPAQAAPASAATPA
PSGDYEDVPVSQMRKTIARRLSESLFTAPHFYLTMEINMDKAMDFRGTVNGISPVKISFN
DFVIKAAALALKQHPNVNSSWLGDKIRKYKYVNIGVAVAVDEGLLVPVVRNADQKTLSTI
SSEVKDLAGKAKDKKLQPKDWEGSTFSISNLGMFGIDEFTAIINPPDSCILAVGGIKQTV
KFEADAAGVPVAKPTNVMKVTLSCDHRVVDGATGSSFLQTFKQLLEDPMRMLV
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattaatccgaatgcccaagatgagcgacacaatgaccgaaggcgtcattgcg
gagtggcacaagaaagtgggcgacaaagtaaaatccggcgatgtactggccgaagttgaa
accgataaggcgacaatggacctcgaagcctatgatgagggtacattactgtatatcggt
gtagagaaaggtgcgtccgtaccggtagatggcgttttagccgttattggtgccgatggt
gaagactataaagcattgctcaacggaacgagcggaggaagccagagtgccgaagcgcct
gctgctcccaagccagaaccggctccggcacccgccaatagcgcgagtaatgaaacggcc
acgaaattgcccgatccaaaggccatctctgccgctccagccgagaacgtcaatgcgtcg
attattcggatgccgaaaatgagcgataccatgacggaaggaaccatcgtggcatggcat
aaaaaagaaggagatacggtgaaatccggcgatgtactggccgaagttgaaaccgataaa
gccaccatggatcttgaagcctacgaagaaggtacattgttgtacatcggcgttaaagaa
gggtcgtctgttgccgttgatgaaatcattgccgttgtcggcgaaaagggcgccaacttt
aaagtattgctggatggcggtggtggtgcacccgcagctggtaatgaagcggctaccggc
gaaggtggcagcgcaacagcccagcaaaatccgcaagccgatttgcccgccgatgccgac
accgatttatcgtacggtggtggcgaaggtgatgttgttggatcgaatggccgtgtgaaa
gcatcgccgttagccaaacggattgccgaagagaagggtattaatctcacgcaggtacat
ggaagtggcccggaaggccgcatcgtgaaaagcgatgtcgagtcatttgttcccggaaaa
actgctcctgcaaaggctgctcctgcagctcaacctgctgcaccggctcctcagcccaca
gctcctgctgctcagtcagcacctgcgcaagccgcccctgcatcggcagcaacgcccgca
ccttcgggcgactacgaagatgttccggttagccagatgcgcaagacaattgcccgtcgt
ctgagcgagagcctgttcactgctccgcatttctacctgaccatggaaatcaacatggat
aaggcaatggatttccgtggcacagtgaatggcataagtcctgttaagatatcgtttaat
gattttgtgatcaaagcggctgcgctggcgctgaaacaacatccgaacgtgaattcatcc
tggctcggcgataaaatccggaagtacaaatatgtcaacatcggggtcgcagtggctgtt
gatgagggcctgctggtgccggttgttcgtaatgccgatcagaaaacgctgtcgactatt
tcgagcgaagtgaaagatctggccggaaaagcgaaagacaagaaacttcagccaaaagac
tgggagggaagtacattctctatctcgaacctcggtatgttcggtatcgacgaattcacg
gcaatcatcaacccacccgattcctgcattctggcggtaggtggtatcaaacaaacggtg
aaattcgaagcggatgcagctggcgttccggtggccaaaccaacgaacgtgatgaaagtg
actctgtcttgcgatcaccgcgtggtggatggtgcgacgggttcatcgttcctgcaaacg
ttcaaacaactgctcgaagatccgatgcggatgttggtataa

DBGET integrated database retrieval system