KEGG   Spirosoma sp. HA7: CWM47_23490Help
Entry
CWM47_23490       CDS       T05236                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
spir  Spirosoma sp. HA7
Pathway
spir00500  Starch and sucrose metabolism
spir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CWM47_23490
Enzymes [BR:spir01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CWM47_23490
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CWM47_23490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase Malt_amylase_C DUF3459
Motif
Other DBs
NCBI-ProteinID: AUD04546
UniProt: A0A2K8Z3S7
LinkDB All DBs
Position
5569248..5570984
Genome map
AA seq 578 aa AA seqDB search
MKKLALLLCIGMFTACQKDADDTKSTTVPPAPLPTDFIEELWYKNGLVYSVDVEVFKDSD
KDGVGDFKGIMQQLDYLKTLGVETIWLAPFQPTPNEDDGYDIADFYGIDKRLGTTQDFDE
FMRQANQKGIRVMMDLVTNHTSNQHPWFQQARQRTDSPYRSWYVWSKERPKKWDSGMVFP
GVQKDIWSYDKQAGEYFYHRFYESQPDLNMQNPAVQREMRKIVRFWLDKGIAGFRVDAVP
FLIEIANKDFDPDKPEHQFDIITQLHEYIQWHKRDAILLGEANVDPKEQEPYFGKEGQNM
QTMFNFFVNQHLFYALATGETKLLKKALDDTKNIPPTAQWAHFLRNHDEIDLGRLSDKER
DKVYARFGPDTTMQLYDRGIRRRLSPMLGDPKLTELAYSILFSLPGMPVIRYGEEIGMGD
DLSLKERLSVRTPMQWSNGPNAGFSESAKTVRPIINKGPYSYTKINVAAQRADSTSLLNQ
VIKFSRLRKRCPEIGWGAWKLIDTGSEHVLAMQYDWQGRTLMMVYNFSKEPQQCQLQTSM
KTGRGLVNLLDSSATQIGSNGSYAVKLPGYGSGWYRAK
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactagccttacttctgtgtatcggcatgttcaccgcctgtcagaaagacgca
gatgacacaaaatcgaccactgttcctccggctcccctgccaaccgatttcattgaagaa
ctctggtataaaaacggactcgtttatagcgtagacgtggaggtatttaaagactctgac
aaagatggtgttggtgatttcaagggaattatgcaacagctcgattacctgaaaacgctt
ggcgttgaaacgatctggctggctccgttccagcctacgccaaacgaagatgacgggtat
gatatagctgacttttatggcatcgacaaacgtctgggtacaactcaggattttgacgaa
ttcatgcgtcaggcgaaccagaagggcattcgggtcatgatggacctggtcacaaatcat
acctccaatcagcatccgtggtttcagcaggcccgtcagcgtaccgattctccttaccgc
tcgtggtatgtgtggtcaaaagaacgcccgaaaaagtgggattcaggcatggtgtttccg
ggcgtccagaaagacatctggtcctacgacaaacaggcgggcgaatacttttatcaccga
ttctatgaatcccagccagacctgaacatgcagaacccggctgttcagcgggagatgcga
aaaattgttcggttctggcttgacaaaggcattgcgggtttccgggtagatgccgttccg
ttcctgatcgaaattgccaataaagattttgaccccgacaaacccgagcaccagttcgac
ataattacccaattgcacgagtacattcagtggcataaacgggacgctattctattgggt
gaagccaatgttgaccccaaggaacaggaaccttatttcggtaaggaagggcaaaacatg
cagacgatgttcaactttttcgttaatcagcacctgttctatgctctggccaccggcgaa
accaagctgctgaagaaggcgctggacgataccaaaaatatacccccaaccgcccagtgg
gcgcattttcttcgtaaccacgacgaaattgacctgggcagactgagcgataaggaacgg
gataaggtatatgcccgcttcggtcctgatacaacgatgcagctttatgaccggggcatt
cgcaggcgtctgtctccaatgctgggcgacccgaaactaacggaattagcctacagtatc
ttattttccttacccggtatgcccgtgattcggtacggcgaagaaattggcatgggcgac
gatcttagcctgaaagagcggctatccgtccggacgcctatgcaatggtcgaatgggccg
aatgccgggttttcggaatcggccaaaaccgttcgacccatcatcaataaaggcccttat
agctacacaaagatcaatgtagcggcacagcgtgcagattcgacctcccttctgaatcag
gtaatcaaattttcccggcttcggaagcggtgtcccgaaattggctggggagcctggaaa
ctcatcgacacaggttcggaacacgtgctggctatgcaatatgattggcagggccgtacg
ctgatgatggtttataattttagtaaggagccgcagcaatgccagctacaaacatcaatg
aaaacgggtcgagggctggtcaatttattggatagttcagcaacccaaattggttctaat
ggcagttatgccgtcaagttgccgggctatgggtcgggttggtatcgggcaaaataa

DBGET integrated database retrieval system