KEGG   Stylophora pistillata: 111319809Help
Entry
111319809         CDS       T05774                                 

Definition
(RefSeq) uncharacterized protein LOC111319809
Organism
spis  Stylophora pistillata
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey Arg_repressor
Motif
Other DBs
NCBI-GeneID: 111319809
NCBI-ProteinID: XP_022778277
LinkDB All DBs
Position
Unknown
AA seq 464 aa AA seqDB search
KLFSGASTQFGAAPNAQVYFVDAGFPGMLPVINQFCVEQAVKTGLGLDATINLTSQFDRK
NYFYPDLPSGYQISQFAHPIISGGHLSIELEDGTEKDIHLERIHMEQDAGKSVHDLHPTK
TYIDLNRAGIALMEIVTRPEIRSSEEAAAFMRKMRSLLRCLGTCDGNMEEGSMRADVNIS
LNRPGDPLGTRAEIKNLNSVRFMVSAIEYEIQRQIEILENGGTIDQETRLLDTNKGITRS
MRSKEDAHDYRYFPDPDLPPLILDLEWVEEIRNTLPELPDARKKRLMEAYGLSAYDASIL
TAGVYTAAFFEEALSKSACVQEGSTKAAKMIANWCTSELFALLNKEGLEISQSKVSAENL
SHLVDFIQKGTISGRIAKEVFTHMWETGQAPGTIIEEKGLKQVSDTGAIEAVIDKILAEN
SDKVEEYKSGKERLFGFFVGQVMKAMQGKSNPQVVNELLKKKFS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
aagctgttttcaggagcgtcaacacagtttggagcggcccccaacgcccaagtctatttt
gtggatgcgggctttcccggcatgcttccggttattaatcagttctgtgtagagcaagca
gtcaaaactggacttgggcttgatgcgaccattaacctcacctcacagtttgaccgtaaa
aactacttttacccagaccttccgtcaggataccaaatttcccaatttgcccaccccatc
atcagtggcggacatttaagcattgaattagaggatggtacggaaaaggatatccatctg
gagcgcattcatatggaacaagacgcaggaaaaagcgttcacgacctccatccaacaaaa
acctatattgacttgaatcgtgcagggattgccttgatggaaattgtcacacgccctgaa
attcgatcttctgaagaggccgctgcttttatgcgcaagatgcgttctcttcttcgatgt
cttgggacatgtgatggaaatatggaagaaggcagtatgcgagccgacgttaatatttcc
ctgaatcgtcctggagacccccttgggacacgggcagaaatcaagaatttgaactctgtg
cgctttatggtttctgctatcgaatatgaaattcaaaggcaaatagagatcttagaaaat
ggaggaacaatcgaccaagaaacacgcctattggatacgaataaaggcatcacacggtct
atgaggtcaaaagaagacgcccatgactatcgttacttcccagatcctgacctacctcct
ctcattttggaccttgaatgggtggaagaaattcggaacacccttccagaacttcctgac
gcaaggaaaaagcgtttaatggaggcctatgggctcagtgcttatgatgcttctatttta
acagcaggtgtttatacagccgctttttttgaagaagcgctttcaaaaagtgcgtgtgta
caagaaggatctacaaaagccgcaaaaatgattgcaaactggtgtactagtgagctgttt
gccttgctgaacaaagaagggttagaaatttcccaatcaaaggtctcagcagaaaactta
tcgcatcttgtcgacttcattcaaaaaggcactatttcggggcgtattgctaaagaagta
ttcacgcatatgtgggaaacaggccaagcacctggaaccattattgaagaaaaaggctta
aaacaagtttcagatacaggggccattgaagccgtaattgataaaattcttgctgaaaat
agtgacaaagtagaagaatataagtctggaaaagaaaggctctttggtttctttgttggg
caagtcatgaaagccatgcaaggaaaaagcaacccgcaagttgtcaatgagttattaaag
aagaaattctcgtaa

DBGET integrated database retrieval system