KEGG   Stylophora pistillata: 111320138Help
Entry
111320138         CDS       T05774                                 

Definition
(RefSeq) uncharacterized protein LOC111320138
Organism
spis  Stylophora pistillata
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 111320138
NCBI-ProteinID: XP_022778564
LinkDB All DBs
Position
Unknown
AA seq 199 aa AA seqDB search
MTFLLPSLPYPKDALEPHISEETLSFHHEKHHQTYITNLNKLLEESDFSQDSLEDIIKKT
SKKSNYAGIFNNAAQVWNHTFYWHSLSPNGGGKPKGTLAEKINQDFESFENFKTAFTQAA
LTQFGSGWAWLVLDQGTLKVVKTGNAETPLTDAQIPLITCDVWEHAYYIDYRNRRPDYVS
TFLDHLINWDFAAENFSKI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgacatttttacttccttctctaccttatccaaaagatgcgttagagcctcatatttct
gaagaaaccttaagtttccatcatgaaaaacatcatcaaacttacataacaaatctaaat
aaactgcttgaagagagtgatttttcacaagattctcttgaagacatcatcaaaaaaaca
tctaaaaaaagtaactatgcaggcatctttaataatgcagcacaagtttggaatcatact
ttttattggcattctctttcaccaaatggtgggggaaaacctaaaggaactcttgcagaa
aaaatcaatcaagactttgaaagttttgaaaacttcaaaacagctttcacacaagccgct
cttacacaatttggaagcggctgggcctggcttgttttggatcaaggaacccttaaagta
gttaaaacaggaaatgcagaaacgcctttaacagatgcccaaatacctctcattacctgt
gatgtttgggagcatgcttattatattgactaccgcaaccgccgcccagactatgtcagc
acattcctagatcacttgatcaattgggactttgcagcagaaaacttttccaagatctaa

DBGET integrated database retrieval system