KEGG   Stylophora pistillata: 111321591Help
Entry
111321591         CDS       T05774                                 

Definition
(RefSeq) myocardin-like isoform X1
  KO
K22525  MKL/myocardin-like protein
Organism
spis  Stylophora pistillata
Brite
KEGG Orthology (KO) [BR:spis00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    111321591
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPEL SAP Pox_Ag35
Motif
Other DBs
NCBI-GeneID: 111321591
NCBI-ProteinID: XP_022780259
LinkDB All DBs
Position
Unknown
AA seq 1001 aa AA seqDB search
MSWNIQRPDGVHEMPPSDGQPSKSHSQLLSNRDALERKLSQREPRQELVNRGIMPAVSAA
PAILSQRTKLERAKTGDLLQKKIRARPNRAQLIQRHILKETPGAVDPSLIDKQMQLKRKK
LEDNLNDKLSYRPGPLELVKENILEAGTPMSQAVQEGTVPFTETTDYLDSFSPESVDSPG
ASPSPDVGQVSSPSSVGSPPVSTSITSSVQALASLQAQTKKHTQQQQAKQQQQHQLFFQQ
QNGFNLTAPTQLPVQVSSTTPKKETAKSRKKAAKPKVKKYKYHEYRPPNGEVQKCELPQD
SPYGLLLQQQQLYLQLQVLYQNYPHHCMLPPIPENVKLGANGSKNGTGSDSEKTVKIEDM
RVIDMRRALKERGLPVFGSKTDLIKRLREAGPLPTEVVPNSSSAAPVVVSTQEQITTSAP
SMSQAFPRTTTHLPVQRSNSLPMQNAQNSSLEAVEQLKMQILANNQSLQQLSVPPEVQQQ
LQQLQYLNLQLQLKHLNIQQQQNIQPKPQNTPVTNQNVAMKKESLTDKNCSFSPPPDHKQ
IKEQKPLFIMQQQGQHVQLSPGNHSPQQQLPHQPKQVDNALAHLQEQAQSLDLSPNNFDS
NPSSVESHVHPWDQQHPLFDGESDSFPSPGSQHSELSNLSPLQMDQLSHSMDTLPNGNLF
QGSVKLESHQMQRSYSERSSSDCPDDYFLMLPQTKPRSLSEPQFPVSTHKRSSSFPSIPF
AAPPPSYEAHMAAQSQKQNRNLSLGGQIGGALAMPSTSPKQDVDLPLESVIQDKELSQEL
HKAMMKNLSSLDHDEILEILGEPRSQLPTSSASFAGVMSTSQSSPAHSFTGSKSPGLGYL
HTLPTHRISKSCEDVSQMPVGNKFPPQMDNGSLSNFDYMLMSPMSPMKVDSCDTDDSSCL
MDHTSNAIPIPTPNNGAGRTDTLGWLDLSLSPSAQILTQQGSTELTHNNNISKGTPPAFL
YDPMTTLKGDEALPYLSLFDLETPTALQPPTDFAETMDYCI
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggaatatccaaagacccgacggtgtccacgaaatgccgccctcggatggccaa
ccatctaagagccattcacaacttcttagtaacagagatgctttggagcgaaagctctct
caaagagaaccccgtcaggaacttgtgaacagaggcataatgccagctgttagtgcagca
ccagcaattctttctcagaggacaaagctcgaacgagcgaagactggtgatttactgcag
aagaaaatacgagcaagaccaaatcgtgctcagctgattcagagacacattttaaaagaa
actcctggtgctgtggatccttcactgatcgacaagcaaatgcaactaaaaaggaagaaa
ctggaagataacctcaatgacaaactgtcatatagaccaggccctttggagctagtgaag
gagaatatcctggaagctggtactccaatgagccaagcagttcaagagggtactgtacct
tttactgaaaccacagattacctggattccttttccccagagagtgttgactctccaggt
gcatctccttcaccagatgtgggccaagtgtcttccccttcaagtgtgggttcaccccca
gtgtcaacaagcataacatcctcagtgcaggctcttgcttctctgcaagcacagactaaa
aaacacactcagcaacaacaagcaaagcagcaacagcaacatcagttgttttttcaacag
caaaatggctttaatctaacagcacctacacaactcccagtgcaggtttcatcaacaaca
ccaaagaaggaaacagcaaagtctcgtaagaaagcagccaagccaaaggttaaaaaatac
aagtatcatgagtatcggccacctaatggtgaggtacagaagtgcgaattgccacaagac
tcaccatatggtttgttattacagcaacagcaactttacctccagctgcaagtgttatac
cagaactaccctcatcattgtatgttgcctcccattccagaaaatgtgaaacttggggca
aatggctctaagaatggcactggtagtgattctgaaaaaactgtgaaaattgaagatatg
cgagtcattgacatgaggagagctctaaaggaacgcgggcttccagtgtttggctctaaa
actgacttaattaagcgcctcagggaggctgggcctctcccaacagaggttgtaccaaac
tccagtagtgctgcacctgttgtggtgtcaacacaagagcagataacaacctctgcacca
agtatgtctcaagcttttccaagaacaacaacccatctaccagtgcagcgctcaaattcc
ttgcctatgcaaaatgcacaaaattcaagtttggaagctgtagagcagttgaagatgcag
atattagcaaataaccaaagccttcaacaacttagtgtgccaccagaagttcagcaacaa
ctccaacagcttcaatatttgaaccttcagttgcaactgaagcacctaaacattcaacag
caacagaacatccagccaaaacctcaaaatacacctgtcaccaatcagaatgtagcaatg
aaaaaggaatctctgacagacaaaaattgttcttttagcccaccacctgatcacaaacaa
ataaaggagcaaaagccattattcataatgcaacaacagggccaacatgtacaattgtca
cctggaaatcattcaccccagcaacagcttcctcatcagcccaaacaggttgataatgct
ttggctcatttacaagaacaggctcagtcattggacctaagccctaacaattttgactct
aatcccagcagtgtggaaagccatgttcacccttgggatcaacaacatcctttattcgat
ggagagagcgattcatttccctcacctggttcacagcactcagaattgtcaaacttatca
cctttgcaaatggatcaactttctcacagtatggatactttaccaaatggtaaccttttc
cagggcagtgtgaaactagaaagtcaccaaatgcaaaggtcatattcagagagatcttca
tctgattgcccagatgactacttcttgatgctgccacagacaaagccacggtcactgtct
gagccgcagtttcctgtttcaacgcataagcgatcatcatcatttccatcgatccctttt
gctgctcctccgccaagttatgaggctcacatggctgcacagtcgcaaaagcagaacaga
aacctttcacttggtgggcagattggtggggcccttgctatgccaagtaccagtcctaag
caagatgtggatttgcccctagagtctgttatccaggacaaggaattatctcaagaactc
cacaaggcaatgatgaagaatctcagttcactggatcacgatgaaatacttgaaatccta
ggagaacctcgcagtcaattgccaacaagtagtgcttcttttgctggagtaatgtcaaca
tcacagtcatcacctgcacactcttttactgggagtaaatcaccaggtctgggatacctg
cacactctaccaacacatagaatttcaaagagctgtgaggatgtaagccaaatgcctgtt
ggcaacaaatttcccccacaaatggacaatggttctttgtctaattttgactatatgcta
atgagccctatgtctcccatgaaagtggattcttgtgacacagatgatagttcatgctta
atggatcacacttccaatgctatacctattccaacaccaaacaatggagcaggaaggaca
gatactctaggctggcttgatttaagcctatcaccatctgcacagattctgacacaacaa
ggaagtactgaacttactcacaataacaatatcagcaaaggaacacccccggcatttttg
tatgaccccatgacaacattgaagggtgatgaggctttaccttatctatctctgtttgac
ctagagactccaacagcactacaaccacccacagactttgcagaaacaatggattattgc
atctag

DBGET integrated database retrieval system