KEGG   Stylophora pistillata: 111322907
Entry
111322907         CDS       T05774                                 

Definition
(RefSeq) uncharacterized protein LOC111322907
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
spis  Stylophora pistillata
Pathway
spis04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:spis00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111322907
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spis01001]
    111322907
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:spis04090]
    111322907
Enzymes [BR:spis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111322907
Protein kinases [BR:spis01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   111322907
CD molecules [BR:spis04090]
 Proteins
  111322907
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Laminin_G_3 fn3 Kinase-like APH
Other DBs
NCBI-GeneID: 111322907
NCBI-ProteinID: XP_022781862
LinkDB
Position
Unknown
AA seq 939 aa
MEGWSTCQDRYHMAGVYKGGCNFLHCIEKIKCCKIVAQDEVVLGHWLLNGEDWDARLYGD
PSFTEGRCLSSKAVTFNQTRSYAIVPAINLGGRSFTIACWIKQTKSVPNEISAIYGDWRF
PWNFLLSITDRQIIFHRHKKGENEWWSADSVNISFDAWTHVVVIWNHESTAVSILADGLE
VAVNSFTSGDSFYKSTADWYQIGNDEHRNDHQFYGSVMDLYVFGSALSLEQVNKLRGVPL
IANKFKSVSGGNVLVVWEPPFEGACPVVKYKVYYREVMSSARQQSSWYSIELDGRHTSYT
LHLSCRKEYDVSVTSISESGESPFNLSKIWNFQTTGIPSPPIITATKSEILGQNVTISWS
HQTAKGCTLTMYSIHYRQIKLRGLEESWYQVNVTDITKTNQTVSLEYDKQYAIEMSAWNE
LGQSERSRPWIITISLGSVHWTTEKPTVKSSVSGSGKLLSTPQLAGLLVGVCILLFVVFI
TLIYFGCAARKRRKYASAPKPRRSKSNIFTLHNWEVLPEQVVFGKEIGRGAFGKVLKGTF
RESPGIEVFIEPRSETVDFKPEETVAIKLLGGKTGDEARNQFLEEIELMKLIGTHPNIVR
MLGCCVHSDPIFLLLEYVPYGDLLHWLRNKRVQKSYQKHYDNFSKPLLVAANVVQTSDED
ESRALLSRSEEESDKDLNTKGTAKEVSTADSQGGLSTESASKEKVHAIDKAQTDEKDKLQ
NHYEKDPIQASQTQXHNDVEREEDFTAKDLLGFVWQVARGMTFLSSKGFVHRDLAARNIL
LGENKVVKISDFGLMRQTHENVYTLKKGKKIPVKWMAPEALHKSEYTTKSDVWSFGILLW
ELSTMGGNPYPGVNNKELYNLLKTGYRMEKPDTSSDTLYQLMLDCWKEEPSERPSFENST
RLLEEMMQEDTPYLDFESLEESKEYYCSPEKLSDDEVTA
NT seq 2820 nt   +upstreamnt  +downstreamnt
atggagggctggagcacgtgtcaagaccggtaccatatggcaggcgtctacaaagggggg
tgtaactttttacactgtattgagaaaataaaatgctgcaaaattgtggcacaagatgag
gtagtcctaggtcactggctgctaaacggtgaagattgggatgcaaggttatatggtgat
ccatctttcaccgagggtcgatgtctcagtagtaaagctgtcactttcaatcaaacaaga
tcctatgcgatagtacctgccataaatcttggaggccggagttttactattgcctgttgg
attaaacaaacgaaaagcgtacccaatgagatttctgcaatttatggtgattggcgtttt
ccatggaattttttgctaagtataacagaccgacagattatcttccatcgtcacaaaaag
ggagaaaacgaatggtggtctgcagatagtgttaatatttctttcgacgcttggacccac
gtggttgttatatggaatcatgaaagtaccgctgtgtcgatattagctgatgggttagaa
gtggcggtgaactcatttacctcaggtgatagtttctacaagtcaacagcggattggtac
cagatcggtaatgacgaacaccggaatgatcaccaattctatggatcagtgatggacctt
tatgtgtttggctcggcactgtcactggaacaagtcaataaactaagaggagttccgctt
atcgccaataaattcaagagtgtgtcaggggggaacgtcctagtggtgtgggagcctccc
tttgaaggagcatgtccggttgtcaagtacaaagtgtattacagagaggttatgtcatca
gcaagacaacaaagcagctggtactcgatagagttggacggaagacacacaagttacacg
cttcatttgagttgcagaaaagaatatgacgtatctgttacctcaatcagcgaatcaggg
gagagtccattcaatctcagcaaaatttggaatttccaaactactggcattccttcacct
cccattataaccgctacaaaaagtgaaatattgggtcaaaatgtcaccatctcctggagt
catcaaacagccaaagggtgtacgcttaccatgtactcaatacactatcgccagattaaa
ctacgaggattagaggagtcctggtaccaagtcaatgtcaccgatattacgaagaccaac
caaactgtatcgttagagtacgacaaacaatatgcaatcgaaatgtcggcgtggaatgag
ctgggacagagtgaaaggtcgaggccatggataataacaatatcattaggttcagttcat
tggactactgaaaaaccaacagtaaagtcctcagtctcaggaagtggtaaactcctttca
acgccacagcttgctggtttattagtgggtgtctgtatccttctgttcgtagtttttatc
acattaatctactttggatgtgcagcaagaaaacgcagaaaatatgcttcagccccaaag
cccaggagatcgaagtccaatatttttaccctccataactgggaagttctaccggagcag
gttgtattcgggaaagagattggtcgcggggcatttggtaaagtgttaaaaggcactttc
agagaatcacctggaattgaggtgttcatcgagcccagaagtgagacggtcgactttaaa
ccggaagaaacagttgcaattaaactccttggaggcaagacaggcgacgaagcgcgaaac
caattcttggaggaaattgaacttatgaaattaataggtacacatccgaatatagttaga
atgctgggatgctgtgtacactcagatcctatctttctcctattggaatacgttccttac
ggggatttgttgcactggctcagaaacaagagagtacagaaaagctatcaaaagcattat
gataacttcagcaagcctttgctagttgctgcaaatgtggtgcagactagcgacgaagat
gagtccagagccttgttatcaaggagtgaagaagaaagtgacaaggatctaaacactaaa
ggtaccgccaaggaggtttcaaccgcagattctcaaggtggcttgagcactgaaagtgcc
tcaaaggaaaaagtacacgctatagataaagcacagactgacgagaaagacaagctgcag
aatcactacgaaaaggatcccatccaagcctctcaaactcagwgtcataatgatgtggaa
cgggaagaagacttcacagccaaagatcttcttggctttgtgtggcaagtagcgcgtgga
atgacattcttatcaagtaaaggatttgttcatcgtgatttggcagctcgtaatattctt
cttggtgaaaacaaagtggtgaaaatttctgattttggactcatgaggcaaacccacgaa
aacgtttacacactgaagaaagggaaaaagataccagtaaagtggatggctccagaagca
cttcacaaaagtgaatataccaccaaaagtgatgtatggtcttttggaattctcctctgg
gaactttctacaatgggaggaaacccttacccaggggtcaataataaagagttgtacaat
cttctcaagactggatatcgaatggaaaaaccagacacctcttctgatacattataccag
ctgatgttagattgttggaaagaggaacccagtgagagaccgtcttttgaaaactccacg
aggttattggaggaaatgatgcaagaggacactccttatttggattttgagtcacttgaa
gagtcaaaggagtattactgcagtccagaaaagctttctgacgatgaagtcaccgcttaa

DBGET integrated database retrieval system