KEGG   Stylophora pistillata: 111324782Help
Entry
111324782         CDS       T05774                                 

Definition
(RefSeq) glutathione S-transferase U20-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
spis  Stylophora pistillata
Pathway
spis00480  Glutathione metabolism
spis00980  Metabolism of xenobiotics by cytochrome P450
spis00982  Drug metabolism - cytochrome P450
spis00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:spis00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111324782
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    111324782
   00982 Drug metabolism - cytochrome P450
    111324782
   00983 Drug metabolism - other enzymes
    111324782
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spis02000]
    111324782
Enzymes [BR:spis01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     111324782
Transporters [BR:spis02000]
 Other Transporters
  Pores ion channels [TC:1]
   111324782
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C GST_N_4 GST_C_5 Fer4_5
Motif
Other DBs
NCBI-GeneID: 111324782
NCBI-ProteinID: XP_022784151
LinkDB All DBs
Position
Unknown
AA seq 236 aa AA seqDB search
MTENKPKLYCAWFCPFAHRAWISMLAKGIDFDYIEQDPYNKSAEWLAINPRGLIPCIVHN
GESIYESHICIEYVDEAWPHAPRLLSKDPYQRAKARMWGDFIIKKLIPPYYRFLIKQSQE
EQNEYKEIFLTNILEFSQAMDQAGPFFQGKELGYVDIMFAPWASRMYILEHYRGFQIPQT
EEYIRYHVWAKAVINHPSVKAVLQNKDKVLANARPYAEGNAKSELADAVRNGSTIP
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaacaaaccgaagctatactgtgcctggttctgtccatttgcacacagagca
tggatctcaatgttagcgaagggaattgattttgattacatagagcaggatccttacaac
aagtctgccgagtggctggctataaacccacgtggattaataccatgtatcgtgcataat
ggcgagtcaatctacgagagccatatttgcattgaatatgttgatgaagcctggcctcat
gcaccaaggctactgtctaaggatccttatcagagggctaaggcacgaatgtggggagat
tttatcatcaagaagcttatcccaccatattaccgattccttattaagcagtctcaagaa
gagcaaaatgagtacaaagaaatatttctaacaaatatattagaattttcccaggcaatg
gatcaggcaggccctttttttcaaggaaaggaacttggatatgttgacattatgtttgct
ccttgggcttcaaggatgtacattctggaacattatcgtggctttcaaattcctcagaca
gaagaatacattagatatcatgtatgggcaaaagcagtgataaatcacccttcagtaaaa
gcagttctacagaataaagataaggttttggcaaatgctaggccttatgctgagggtaat
gctaagtctgagcttgcagatgctgttcgcaatggttcaacaattccctag

DBGET integrated database retrieval system