KEGG   Stylophora pistillata: 111325010
Entry
111325010         CDS       T05774                                 

Definition
(RefSeq) caspase-3-like
  KO
K04489  caspase 3A [EC:3.4.22.-]
Organism
spis  Stylophora pistillata
Pathway
spis04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:spis00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    111325010
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:spis01002]
    111325010
Enzymes [BR:spis01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     111325010
Peptidases and inhibitors [BR:spis01002]
 Cysteine peptidases
  Family C14: caspase family
   111325010
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 111325010
NCBI-ProteinID: XP_022784432
LinkDB
Position
Unknown
AA seq 358 aa
MLGPCYKPEDSNLVSSADHTSIFTSVITSVILLSYFRLLPLVAVQGISTLVFTHRFRLRR
PSSMHKFNVTVNECSNIVVGDNANLTIRASNGIPQQRHVPEQATATNATAHAPFQESGDA
IDYKAKSGYVLLIHNYSFPKRRDTERQWSAEDVKGLTSLFDDFNFTIKTRNNLEQSEILE
LLQDASEKDFGKYDCFVCVILSHGSKDGIYGTDDVSINIEAITSYFRRDRCPSLEGKPKI
FLIQACRGSQQDSIPIESDSEPIPYASSSLPADADFLICFASAPGHERYRQPELGSWFIS
AVVKIFKEYAGKEHLMDMMLRVNNHVANFFSNTGLKQIPCQVCMLRRKVFFNPSYNTL
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgcttgggccatgctacaaacccgaagactctaatttggtgtcttccgctgaccacaca
tcaatctttacttccgtgattacttctgttatccttctgtcatacttccgccttcttcct
cttgtagcagtgcaaggaatttctacgttggtctttacgcaccgttttcggctacgaaga
ccttccagcatgcacaaattcaacgtaactgtaaacgaatgcagtaatatcgtagttggg
gataatgcaaatttgacaattagagcgagcaacggaataccacagcaacgtcatgttcca
gagcaagcaacggcaaccaatgccacagcccatgcaccttttcaagagtctggggatgct
attgattacaaggcaaagtctggctatgtgctacttattcataactacagcttccccaag
aggagagacacggaacgccaatggtcagcggaagatgtaaaaggtctcactagtctcttc
gatgattttaatttcactatcaagactcgcaacaacttggaacaaagtgaaatcttagaa
ctactgcaagacgcatcagagaaagactttggcaaatatgattgttttgtttgtgtaatc
cttagccatggttctaaagatggaatttatggaacagatgatgtttcaatcaacattgaa
gcaattacttcctattttcgccgggacagatgtccatcccttgaaggaaaaccaaaaata
tttctgattcaagcttgccgtggtagtcaacaggatagcatacctatcgagagcgacagt
gagcctattccatatgcaagctcatctctgccagctgatgctgattttctgatctgcttt
gcctctgcccctggtcatgaaagatacaggcagccagagcttggttcttggtttatttca
gcagttgttaaaatattcaaagagtatgcaggaaaagagcatctcatggatatgatgttg
agagtcaacaaccatgtcgctaattttttcagcaacacaggcctcaagcaaattccttgc
caagtctgcatgctgagaagaaaagtgtttttcaatccttcttataacactttatga

DBGET integrated database retrieval system