KEGG   Stylophora pistillata: 111326802Help
Entry
111326802         CDS       T05774                                 

Definition
(RefSeq) metalloproteinase inhibitor 3-like
  KO
K16866  metalloproteinase inhibitor 3
Organism
spis  Stylophora pistillata
Brite
KEGG Orthology (KO) [BR:spis00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:spis01002]
    111326802
Peptidases and inhibitors [BR:spis01002]
 Peptidase inhibitors
  Family I35: timp family
   111326802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIMP NTR MSP1a tRNA_bind_2
Motif
Other DBs
NCBI-GeneID: 111326802
NCBI-ProteinID: XP_022786614
LinkDB All DBs
Position
Unknown
AA seq 223 aa AA seqDB search
MAVLLFICTVLLCVVTKNEACWCTQAHPQSRFCSADFAIRAKVLNESRDNSSRIYTLKVF
KAFKGGKKIDRIAEMQSEPGKRRKNVVQVTTELDSTACGVRLQMSQVYVLLGYVEIQHRR
PSKLKKRLTIESCQWHTLWNNTTAQQRRGLKKIYGKYCSCNIDKYCFKERPELCTNLIQG
CHIQGSDDRMKDCRAKHSYCVKGRKKCRWIAPKKADFKKCMNA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcagttcttcttttcatttgtacggtcttattatgtgtagtcaccaaaaacgaggca
tgctggtgcacacaagcccacccacagtcaagattttgcagtgcagattttgccattcgc
gctaaggttttgaacgagtctcgggacaacagcagcagaatctacaccctcaaggtcttc
aaagccttcaaaggaggcaagaaaattgaccgtatcgccgagatgcaaagtgaaccggga
aaacgcaggaaaaacgttgtccaagtcacaacagagctcgactcaaccgcttgcggcgtg
cgccttcagatgtctcaagtctacgttctgctcggctacgtagagatccaacatcgaaga
ccatccaaactaaagaagaggttgacgatagaatcgtgccagtggcacacgttatggaac
aacaccactgctcaacaacgtcgcgggctaaagaagatttatggaaaatactgctcgtgt
aatattgacaagtactgtttcaaagaaagaccagagctctgcacaaatttgattcaagga
tgccacatacaagggagcgatgatcgcatgaaggattgcagagcaaagcattcttactgt
gtgaaaggccgcaaaaaatgtagatggatcgcgcccaaaaaggccgatttcaaaaaatgc
atgaatgcttga

DBGET integrated database retrieval system