KEGG   Stylophora pistillata: 111327055
Entry
111327055         CDS       T05774                                 

Definition
(RefSeq) uncharacterized protein LOC111327055 isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
spis  Stylophora pistillata
Pathway
spis04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:spis00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111327055
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spis01001]
    111327055
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:spis04090]
    111327055
Enzymes [BR:spis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111327055
Protein kinases [BR:spis01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   111327055
CD molecules [BR:spis04090]
 Proteins
  111327055
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase CUB EGF_3 EGF_CA EGF EGF_MSP1_1 hEGF DUF4690 cEGF Kinase-like ATE_C
Other DBs
NCBI-GeneID: 111327055
NCBI-ProteinID: XP_022786877
LinkDB
Position
Unknown
AA seq 903 aa
MDCYWLVQVSQGNRIELNFLDFAMDAIRSEEVGTCPYDYVVVMDGSFGSTNIVIRLCGTT
INTLSSCGGQKTMVSTTNSVLVHMHTDDKNENRGFIASYQGICKVIFSSVSGTIMSPNHP
NNYPNGAKCEWIIDLGPGYNITLTFHKFVLETKENCEYDWVRVQEGNNEDSPKKGTFCSD
VLPPDITTVGPMRIVFESDGDKEYEGFYMTWLAQDRNECLEPDICHANATCANTAGSYQC
TCKLSYTGDGKSCTWYKDFNECESNLDNCHVDAICINTPTHFECMRKPGFLGDGLSCVDR
NECLEPGICHANATCANTAGSYQCTCMLSYTGDGKFCTWYKDFNECDLNLDNCHEDALCI
NTLTHFECKCEPGYLGDGLNCTVKANVSLNNSEATTKTPGTTELDLPPPSMGNNSEQVKG
STLPTDKRGSIPGIITGVVVAVVMGTIVLIFKRWKVKQKRLRGVKTKRSKSDIVHFLKEE
VYPDRVTLHEELGRGAFGKVQRGVLRKLPSTEVFRMQREKRAEVCEETVVVAVKVLFDAA
CEEGKHQFLREIELMRKIGSHKNVLSMLGYWIKSEPIMLILEYVPHGDLLQWLRDKRQYI
SSQQQDLYEGKQCIGEGENDEGRRIPGDESRGVSGAINLTGADNACKVVNLTEADMACRV
EIAPTLLENEEKKGTPQKNGIPCQVVNTEVQSSDEQHINSCSNDLSVKDLVCFAWQITQG
MDYLASKEFVHRDLAARNVLLGEGRTVKIADFGLLRHTYGEIYEAKQKKKLPIKWTAPEA
LCHGSYTSKSDVWSFGVVLWEMATMGGIPYPGISNKELYKLLKTGYRMEKPDMCSDEIYN
LILECWKEDPSERPTFRDLIPTLEEMMTKDTPYYDFDKLDENDACYDEVISDSSDTCDAD
TPL
NT seq 2712 nt   +upstreamnt  +downstreamnt
atggattgttactggctggtacaagtgtcacaaggaaatcgcatcgaattaaactttcta
gattttgcgatggacgccattcggagtgaagaagttggcacttgtccttatgattatgtt
gttgtaatggatggttcctttggcagcacaaacatagttatacgactctgtggcactaca
atcaacactctatcatcatgtggcggccagaagacgatggtttcgacgactaactcagtg
ctcgtgcatatgcacacagacgacaagaacgaaaatcgaggatttatagctagctaccag
ggtatttgtaaagtgattttctcttcagtcagtggaaccatcatgtccccaaatcatcca
aataactatccaaacggcgctaagtgtgagtggatcattgatcttggtccaggatataac
ataacccttacatttcataaatttgtcttggaaacaaaagaaaattgtgaatatgattgg
gttagagtacaagagggaaacaacgaagactccccaaaaaaaggcactttctgctcagat
gtgctgcctcctgatataacaactgttggaccgatgaggattgtctttgaatcggatggt
gacaaagagtacgaaggattttacatgacatggttggcacaggatcgaaacgaatgtctt
gaacctgatatctgccatgccaatgcaacttgtgctaacacagcaggttcctatcagtgc
acctgtaagctgagttacactggggacggtaaatcctgtacgtggtacaaagattttaat
gagtgtgagtcaaaccttgacaactgccatgtggacgccatttgtataaacacgcctacc
cattttgagtgcatgcgtaaacctggcttcttaggagatggcctttcctgtgttgatcga
aacgagtgccttgagcctggtatctgccatgccaatgcaacttgtgctaacacagcaggt
tcctatcagtgcacctgtatgctgagttacactggagacggtaaattctgtacgtggtac
aaagattttaatgagtgtgacttgaaccttgataactgccatgaggacgcactgtgtata
aacacgcttacccactttgagtgcaaatgtgaacctggctatttaggagatggccttaac
tgtactgttaaagcaaatgtttcactaaataattcggaagccacaacgaaaacaccaggg
acaactgagttagatcttccaccgccttctatgggaaacaactctgaacaagtcaaagga
agtaccttaccaactgacaagagaggttctatcccaggaatcatcactggagttgttgtt
gctgttgttatgggaacgattgtgttaatctttaaaagatggaaagtcaaacaaaaacga
cttcgtggtgtcaaaacaaaaagatcgaagtctgacattgtccacttcctgaaagaggaa
gtctaccctgatagggtaactctccatgaagaactgggccggggggcttttggtaaagtt
caaagaggagttttaagaaaattaccaagcactgaagtatttcgtatgcaaagggagaag
agagcagaagtctgcgaagaaactgttgttgttgctgtgaaagtgttattcgatgcagcg
tgcgaggaaggaaaacatcagtttctacgggaaattgagcttatgagaaaaattggttct
cacaagaatgtactttctatgctcggctactggatcaagtcggaaccaatcatgttaatc
ttggaatatgttccgcacggagatcttcttcagtggttaagagacaaacggcagtatatt
tcatcgcagcaacaagacctctatgaaggaaaacaatgcattggagaaggagagaacgac
gagggaagacggattcctggtgacgaatccagaggtgtttcgggggcgataaatttgacc
ggagctgacaacgcctgcaaggtggtaaatttgacggaggcggacatggcttgtcgagta
gaaatagctcctacgttgttggaaaatgaggaaaagaaagggacgccacagaaaaatggc
atcccctgtcaagtggttaacacagaggttcagtcgtcagatgaacaacacatcaactca
tgttcaaatgacctttctgttaaagatcttgtttgttttgcgtggcaaataactcaaggg
atggattacttggccagtaaagaatttgttcaccgtgatctggcggcccgtaatgttctt
cttggtgagggtagaactgttaaaattgctgactttggactgttacgtcatacgtatggt
gaaatatacgaagcgaaacagaagaagaaactgccaatcaaatggacggcaccggaagcg
ctctgtcacggcagctatacttctaaaagtgacgtgtggtccttcggagtagttctgtgg
gaaatggcgacaatgggcggaattccatatcctggaataagcaacaaagagttgtacaaa
cttcttaagactggatatcgaatggaaaaaccagacatgtgttctgacgaaatatacaat
ctaatactggagtgctggaaggaagatcccagcgaaagaccaacattcagggacctgatt
ccaacactggaagaaatgatgactaaagacactccttactacgacttcgacaaactggac
gagaatgatgcttgttacgatgaagtcatttctgacagcagtgacacttgcgatgcagac
actccgttataa

DBGET integrated database retrieval system