KEGG   Stylophora pistillata: 111331523Help
Entry
111331523         CDS       T05774                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha-like isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
spis  Stylophora pistillata
Pathway
spis04140  Autophagy - animal
spis04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:spis00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111331523
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111331523
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spis01001]
    111331523
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:spis03019]
    111331523
   03036 Chromosome and associated proteins [BR:spis03036]
    111331523
Enzymes [BR:spis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     111331523
Protein kinases [BR:spis01001]
 Serine/threonine kinases: AGC group
  PKA family
   111331523
Messenger RNA biogenesis [BR:spis03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     111331523
Chromosome and associated proteins [BR:spis03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    111331523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 111331523
NCBI-ProteinID: XP_022792382
LinkDB All DBs
Position
Unknown
AA seq 349 aa AA seqDB search
MGNAPTKKGDPENVKAFLTEAKEEFNSKWEHPSQNTASLEDFERVKTLGTGSFGRVMLVQ
HKSSHKFYAMKILDKQKVVKLKQVEHTLNEKRILQAITFPFLVNLEWHFKDNSNLYMVLE
FVLGGEMFSHLRRIGRFSETHSRFYASQIVLAFEYLHSLDLIYRDLKPENLLIDEKGYLK
VTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFAD
QPIQIYEKIVSGKVRFPSHFTADLKDLLRNLLQVDLTKRYGNLKNGVGDIRGHKWFSSTD
WIAIYQRKVEAPFIPKCKGPGDPSNFDDYEEEPLRISTSEKCAKEFADF
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgctccaacgaagaaaggagacccagaaaacgtcaaagctttcctgaccgag
gctaaagaggagttcaattcaaaatgggagcacccctctcagaatacggcgagtttggag
gacttcgagcgagtgaagaccttgggtaccggatcatttggtcgggttatgctcgttcaa
cataagagcagccacaaattttatgccatgaaaattctagataaacagaaggtggtgaag
ctgaagcaagtggaacacactttaaatgaaaaaaggatcctgcaggcaataacttttcca
ttcctggtgaacctggaatggcattttaaggataattccaacttgtacatggtattagaa
tttgtacttggaggtgagatgttttctcatctacgacgtattggaagattcagtgaaaca
cactcaaggttttatgcctcgcagattgtgttggctttcgagtaccttcactcattagac
ctcatatacagggatctaaaaccagagaatcttctcattgacgagaaaggttacttaaag
gtaacagattttggttttgcaaagagagtgaaggggagaacttggactctgtgtggaaca
ccagaatacctggcacctgagatcattcttagcaagggttataacaaagctgtggattgg
tgggctttaggtgttcttatctatgaaatggcagctggttaccctcctttctttgccgat
cagccaattcagatttatgaaaagattgtctctggcaaggtacgattcccatcacatttt
acagctgatctgaaagacttgcttcgaaatctattacaagttgatctgacaaaaagatat
ggaaatctaaagaatggcgtgggagacatccgaggtcacaagtggtttagttccacagac
tggatagctatctatcaacgaaaagttgaagccccctttattcccaaatgcaaaggtcca
ggagatccaagcaactttgacgattatgaggaggaaccgctgcgcatttctacctctgag
aagtgtgcaaaagaatttgctgatttctaa

DBGET integrated database retrieval system