KEGG   Stylophora pistillata: 111333604
Entry
111333604         CDS       T05774                                 

Definition
(RefSeq) fibroblast growth factor 1-like
  KO
K18496  fibroblast growth factor 1
Organism
spis  Stylophora pistillata
Brite
KEGG Orthology (KO) [BR:spis00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:spis04052]
    111333604
   00536 Glycosaminoglycan binding proteins [BR:spis00536]
    111333604
Cytokines and growth factors [BR:spis04052]
 Growth factors
  Growth factors (RTK binding)
   111333604
Glycosaminoglycan binding proteins [BR:spis00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   111333604
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 111333604
NCBI-ProteinID: XP_022794952
LinkDB
Position
Unknown
AA seq 231 aa
MAPSMLRVSLCLIWAVLALSPFPYVVSRPSRIRRPRCIHSKNDDIDGINASSENIRINYQ
IFKVASKTPSHVQIVQLFCKTGYFLALNVTARKNRIVGIVNESSESTFFESQSLGTSIVR
LRNIVSGRFLAINSKGRIITQSKVSDESVFKTMYEENYFHTFTSHKYFKNKRHDLFLGIK
QNGRCKSPKLTYPGQISVQFLLLHNNNTEEKMRITAPARQSRVKQGRRDMG
NT seq 696 nt   +upstreamnt  +downstreamnt
atggctccgtcgatgcttagagtttcattgtgccttatttgggcggtgttagctctttct
ccattcccgtatgtggtatccaggccctctcgtatacgccgccccagatgtattcactct
aaaaacgatgacatcgacgggatcaacgcatcgtcggagaatattcgaataaactaccag
atcttcaaagttgcatctaaaactccctctcatgtacagattgtgcagctcttttgcaag
acgggatattttttggcgctaaatgtcacagcaaggaagaaccgtatcgtcggtatcgtc
aatgaatcaagtgaaagcacatttttcgagtcccaatcccttggaacgagtatagtcagg
ctgcgaaatattgtcagcggaagatttttggcgatcaattcaaagggaaggattattaca
cagtctaaagtttcggatgaaagtgttttcaagacgatgtacgaggaaaactacttccat
acatttacttcgcataaatatttcaagaacaaacgacatgacctgttccttggaatcaaa
caaaatggacgctgcaagtctccaaagctgacatatcctggacaaatctcagttcagttt
ctgttgctgcataacaacaacaccgaggaaaaaatgagaataacagcgcctgcaagacaa
agtcgcgtgaaacaagggaggagagacatgggctaa

DBGET integrated database retrieval system