KEGG   Stylophora pistillata: 111338467
Entry
111338467         CDS       T05774                                 

Definition
(RefSeq) ras association domain-containing protein 1-like isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
spis  Stylophora pistillata
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2 ARF7EP_C
Other DBs
NCBI-GeneID: 111338467
NCBI-ProteinID: XP_022800713
LinkDB
Position
Unknown
AA seq 467 aa
MRTELQNGNRNLPKNRILDWLTLRLLLIFERGLLALLYLITQSTALVMESDDVFLNEETK
PQNPNSLDRNRAEIKSHMANDRDRTRAISVPHIPAAKHTASNPVKDFIANFVNRKGPKKR
STIKRSVTTENVSDEKALVRHVGSGHSFIQHQLRNPTWCDCCGEFIWGIFKQCVRCKNCK
YTCHRRCKEDVDLDCTGSWLYERMMSVDEVTMKTLHLVGQGEKRKEPFMLYTESPTGSLL
RRKIDEFNSSTTGLIMSMRTEETYQGFIRVNMNLLRPIHIKEGETPLSIFQTAVLSNDDD
LNHKSSRRTTFFLPLETEKALHVTSETTVHQVIVALLKKFKVADNPRKFALFECYQEEDD
HVILRRMSDFEKPLVLRLLWGGADIRHKFSLQENETGDIVWEVFTTPELQNFMKILDREE
EEHILQVEEKYRLYKERLEQALALVQPNQTVCDEKPPSDESDETARL
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgcgaactgaattgcagaacggcaatcgtaatttgcccaagaacagaatcctcgactgg
ttaacattgaggttgttgctcatttttgaaagaggtttgttggctcttctctatctgata
acacaatcaacagctttggtaatggaaagtgacgatgtgttcttgaacgaagaaacgaaa
cctcaaaatcccaactctctggatagaaatcgtgctgaaataaaatctcacatggcgaac
gatcgggacaggactcgcgctatatctgtacctcatatccccgcagcgaaacatactgca
agtaatccagtgaaagatttcatcgcaaactttgtcaataggaaaggacctaagaaacga
agcactataaaacgatctgtgaccaccgaaaatgtaagcgacgagaaagcgctggttaga
catgtcggtagtggtcattcgtttattcaacatcaactacggaatcctacatggtgtgat
tgttgtggagagtttatctggggaatcttcaagcaatgtgtgcgctgcaaaaattgcaag
tacacatgtcataggcgatgcaaagaggatgtggatttagactgtaccggaagttggctg
tatgaaagaatgatgtcagtggatgaggtgaccatgaagacattacatcttgtaggccag
ggagagaagagaaaagaacctttcatgctttacacagaatccccaacaggaagccttctt
cgcaggaaaattgatgaattcaattcaagcacaactggacttataatgtccatgaggact
gaggagacataccaaggcttcattcgtgtgaatatgaacttgctccgtccaatccatatc
aaagaaggagagacacccctgtcaatttttcagacagccgtgctgtcaaacgatgatgat
ctgaatcataagagctcacgacggacaacattttttcttccactcgagacagagaaagct
ttacatgtgactagtgaaactactgttcaccaggtcattgtagctctccttaagaagttc
aaggtagctgataatccaagaaaatttgcattatttgaatgttaccaagaagaagatgac
cacgtcattcttcgtcggatgtctgactttgagaaacccctggtgctaaggttactttgg
ggtggagcagacataagacacaagttctcactccaggagaatgaaacaggagatattgtg
tgggaggtattcacaacaccagagcttcaaaatttcatgaagatactggacagagaagag
gaagaacatatattgcaggtggaagaaaagtacagactttacaaggaaagactagagcag
gctttagcactggtgcaaccaaaccaaacagtctgtgatgaaaaaccaccttctgacgag
tcagatgaaacagcaagattataa

DBGET integrated database retrieval system