KEGG   Stylophora pistillata: 111338863Help
Entry
111338863         CDS       T05774                                 

Definition
(RefSeq) uncharacterized protein LOC111338863
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
spis  Stylophora pistillata
Brite
KEGG Orthology (KO) [BR:spis00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spis01001]
    111338863
Enzymes [BR:spis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111338863
Protein kinases [BR:spis01001]
 Receptor tyrosine kinases (RTK)
  RET family
   111338863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Ig_3 Ig_2 I-set ig Ig_5 Tissue_fac C1-set OSTbeta Miga Haspin_kinase TMEM154
Motif
Other DBs
NCBI-GeneID: 111338863
NCBI-ProteinID: XP_022801145
LinkDB All DBs
Position
Unknown
AA seq 974 aa AA seqDB search
MKKMHQSPKGLVFVVCIITATGFIQAIVYPRMIAAPKKPTEAFTGDTVSLRWHYNSGDLK
DDLYEVVFGIWKSPGFLKTKLIAVNSSGFSLTRSTHKSSVGWAGNLTSSIAVFELYNVKL
EDGKKYGIVVEYGLQHTPLTDTVYLKVKSRPILNLPRITNISEPPPLRRGQNVNLICTAK
SLSPVNVTWKRNDKVLVSGISEAILTLRNITAEHCGDYVSVAKNSDGEDTRTVVLKVLPE
SPTILNSHKIVKRPHWTLRWSAVKSDEVLVKYTVRQKREGEESWLQKNVTGNILQIRLKD
ARSYLFVVTAWNRCGESMLDRAKMINISTDFEVRTAPPSDISLATFSTEPEAALTPFFSS
RQKDESPWKMEIIILMALGVIFLILIAILVIRRKTSKDKETGQRSQNLRNKGMSPSLKLR
EKPSFEQAPDNSVGREPLTTEGTSPRLSESSLTTEQPVSVIGANTNEGTEETPEMSSTTA
AYSSGQQVLSFTTFSLCKVAAVPNAGNEKTLQVQEEATIQCLDTFTRNKPPTDTTQGLKH
SEDYLQPVEHLHLQPAFQNRGSFRCCGGKIQTLPQGRPVPKPRGKMSTFAGITSTSRLCQ
VVQQRAGVQRVNQSKFCTHHARDLQEEHSYQNDTCAAIPYESPRRPQSFLPSASRKESPY
VKVQSTANWEVAGESLRLFKRVGGGTFGQVWEGAVLDVCGTVGWSIVAVKMLKENSSKSD
RMDLLSELDMLKRLKPHPNVIQLLGCLTKDVVRRKGGREFRPPLVILEFVPHGDLLGYLK
KSKGETDDYYDVKCAETSLKIPTVQLYKFACDIARGMAFIAAHQFVHRDLAARNVLVGEG
LRCKITDFGMARDLGKDKIYVRRSNGVVPVKWMAVESLTKQIFTTESDVWSYGIVLHEIF
TLGGNPYDGMSGQEVFTYVSHGHRLHRSSGVSADLYELMFQCWNQEPSLRPTFESITSWM
ETLADSHSQYISWA
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgcaccaaagcccgaaaggacttgtatttgtcgtctgtattatcacagca
acaggattcattcaagctatagtttatccaagaatgatcgctgctcctaaaaagccaaca
gaagccttcactggcgacactgtttcattaaggtggcactacaattcaggagatttgaag
gatgatctttacgaggtggtttttggtatttggaagagtcctgggttcctgaaaacaaag
ttgatagctgtcaactcaagtggtttttccttaacgaggtctacacataagtcatcggtg
ggttgggcaggaaatttgacatcctctatcgcggtgtttgaactttacaatgtaaaactc
gaagatggcaagaagtatggaattgtggtagaatacggtctccagcataccccgctgacc
gacacagtttaccttaaagttaagtccagacccattctcaatctaccaagaatcacaaac
atcagtgaaccgccgccgctcaggagaggacagaatgtgaaccttatatgtactgctaaa
agcttgtctcctgttaacgtcacgtggaagagaaatgacaaagtattagtaagcggtatt
tctgaagccatattgaccctaagaaacattacagccgagcactgcggtgattacgtttct
gtcgctaaaaactctgacggagaagacactaggactgtggtcctaaaagtacttccggaa
agtccaaccatactgaactcacacaagatagtaaaacgtcctcactggacactacgatgg
tcagcggttaaaagtgatgaagtgctggtgaagtatacagttaggcaaaaacgtgaaggc
gaagaatcatggctgcagaaaaatgttacaggaaacatattgcagatcagacttaaggat
gctagatcttacttgttcgtggtgacagcttggaacaggtgtggagagagtatgttagac
agagccaaaatgatcaacatatccaccgactttgaagtcagaactgcaccaccaagcgac
atatctctcgcaacattttctacagagcctgaggctgcactgactccattcttcagcagc
agacaaaaggacgagtccccatggaaaatggaaatcatcattttaatggctctgggtgtc
atttttttaatattaattgcaattttggtgatacgaagaaaaactagcaaagacaaagaa
actggccaaaggtcccaaaatttaaggaacaaagggatgtccccatctttaaagttacga
gagaaaccttcctttgaacaggctcccgacaattctgtaggtagagaaccattgacgaca
gaggggacttcaccaagactttcagaatcctctttgacgacagaacaaccagtctcagta
ataggggccaacaccaacgaaggaacggaagagacacctgaaatgagctccactactgct
gcatactcatctggtcagcaggtcttgtcttttaccactttttctttatgcaaagttgct
gcggttccaaatgcaggaaatgagaagactctccaagttcaagaggaagcgacaatccaa
tgtcttgacacgttcaccagaaacaaacctccaactgacacaacccaaggtctgaagcat
tcagaagattacctgcaaccggtggaacacttacacttacaacctgcgtttcaaaacaga
ggtagcttcagatgttgtggtggaaagatacaaactttgcctcaaggtcgccctgtgcct
aagcctagaggaaaaatgtccacgtttgcaggaataacgtcaacttcgcgattgtgccag
gtagttcaacaacgtgcaggtgtccaacgtgtcaaccaatcaaagttctgcacccatcat
gcaagagatcttcaagaagagcacagttatcagaatgatacatgtgcagcaatcccctat
gagagcccaagacgtccacaatcatttttaccttctgcttccaggaaggagtcaccatac
gtgaaggtgcagagcaccgccaactgggaggtggctggcgaaagtttgagactttttaaa
agggtcggcggtggaacattcggtcaagtgtgggaaggtgctgtattggacgtgtgtggt
actgtaggctggtctattgtggctgttaaaatgctgaaggaaaattcatcgaagtcggat
cgaatggatttgctgtcagagctggacatgttgaagagacttaaacctcatcctaacgtg
atacaactgttgggctgcttgacaaaagatgtagtccgacgtaaaggagggcgagagttt
aggccgcctcttgttatcctggagtttgtgcctcatggtgatctcctgggatatctaaag
aaaagtaaaggggaaacagatgactactacgacgttaaatgcgcagaaacttcgttgaaa
ataccaacagtacaactttacaaattcgcttgtgatattgcacggggaatggcgttcata
gcggctcatcagttcgttcaccgagacttagcagcgaggaacgtgttggttggtgagggt
ctacgctgtaaaatcactgactttgggatggcgagagatcttggcaaagataaaatttat
gtcaggaggtcgaatggagttgtaccagtaaagtggatggcagttgaatcactaacaaaa
caaatttttaccacagaaagtgatgtgtggagttatggcatcgtcctgcacgagatattc
acactcggggggaacccttacgatggaatgagcggacaagaagtctttacatacgtgtca
catggtcacagattgcataggtcgtcaggcgtgagcgcagacttgtatgaattgatgttc
cagtgctggaaccaagagccctccctgcgaccaaccttcgaatcaattacttcgtggatg
gaaactttagcggatagtcactcccaatacataagctgggcgtaa

DBGET integrated database retrieval system