KEGG   Stylophora pistillata: 111342152Help
Entry
111342152         CDS       T05774                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
spis  Stylophora pistillata
Pathway
spis00020  Citrate cycle (TCA cycle)
spis00190  Oxidative phosphorylation
spis01100  Metabolic pathways
spis01200  Carbon metabolism
Module
spis_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:spis00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111342152
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111342152
Enzymes [BR:spis01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111342152
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DUF2369 HI0933_like DAO
Motif
Other DBs
NCBI-GeneID: 111342152
NCBI-ProteinID: XP_022804935
LinkDB All DBs
Position
Unknown
AA seq 629 aa AA seqDB search
MFSGLKSRSLLSSIKSTGLARSALRSSGCRAFHFKIEGRRSQDGTAKGQLSREYPVVDHN
YDAVVVGAGGAGLRAAFGLAHEGFKTACITKLFPTRSHTVAAQGGINAALGNMEPDDWRW
HMYDTVKGSDWLGDQDAIHYMTEEAPKSVIESLRYETEYFVEYFALDLLKGHSLRYETEY
FVEYFALDLLMDKGKCVGVIALCLEDGSLHRFKAKNTVIATGGYGRAYFSCTSAHTCTGD
GTAMVARAGLPNQDMEFVQFHPTGIYGAGCLITEGSRGEGGYLINSEGERFMERYAPTAK
DLASSDVVSRSMTIEIREGRGVGPDKDHVYLQLSHLPSETLKTRLPGISETAMIFAGVDV
TRDPIPVIPTVHYNMGGIPTNYMGQVLTKKEGKDEVVPGLWAAGESACASVHGANRLGAN
SLLDLVVFGRACANFISKFNKPHETLPELPLNAGEESVANLDKIRYANGSTPTADLRMNM
QKTMQEHAAVFRTGTVLAEGCRKIDDIYSQTEDLKLFDRGMVWNTDLVETLELQNLLINC
KQTLYGAEARKESRGAHAREDFKERIDEYDYSKPLEGQTNRPFDSHWRKHTLAWTEPNTG
ETTLDYRGVIDETLDQKDCASVPPAVRSY
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgttctcaggactgaagagcaggtctcttctttcttctataaagtcaaccgggttggcg
agaagtgccttacgatcgtccggttgtagggcttttcattttaaaatcgaaggtagacgc
tcacaagatggtacagccaagggacagttgtcacgggaatatcctgttgtggaccacaac
tatgacgctgtagttgttggtgccggtggtgctggtttacgtgcagcctttggtcttgca
catgaaggatttaaaactgcttgtatcaccaagcttttcccaacaaggtcacatactgtt
gcagcacagggaggaatcaatgctgcccttggaaacatggaacctgatgactggcgttgg
catatgtatgacacggtgaaagggagtgattggcttggggatcaggatgcaatccattac
atgacagaggaagcaccaaagtcagtgattgagtccttgaggtatgaaacagagtacttt
gtggagtattttgcactggatctcctcaaaggtcactccttgaggtatgaaacagagtac
tttgtggagtattttgcactggatctcctcatggacaaaggaaagtgtgttggagttatt
gccttgtgccttgaggatgggtcgctgcacagatttaaggcaaagaacacagtgatagca
actggtgggtatggacgtgcttatttctcgtgtacatcagcacacacctgtactggagat
ggaacggccatggtggcaagagcaggacttcctaaccaagacatggagtttgtacagttt
catccaacaggaatttatggcgctggttgtctgattactgagggaagcagaggagaaggc
ggctatctcatcaacagtgagggagagaggttcatggagaggtatgcacctacagcaaaa
gacttggcatcaagtgatgtggtgtccagatccatgactattgagatcagagaaggaaga
ggggtggggccagacaaggaccacgtgtaccttcaactgtcccatcttccatccgagaca
ctaaagacacggttgcctggaatctcagagaccgctatgatctttgctggagtcgatgtg
acgagggaccccatccctgtaattcccacagtgcattacaacatggggggtatccccaca
aactacatgggtcaggttctgacgaagaaggagggtaaagatgaagtcgtaccaggccta
tgggcggcaggagagtccgcgtgcgcctcggtccacggtgcaaacagactgggtgcaaac
tccttgttggatctggttgtgttcgggcgagcatgcgcaaattttatttctaaatttaac
aagccacatgagacacttccagagctcccgttgaacgctggagaggagtccgttgctaac
ttggacaaaattcgttacgccaacggaagtacacctactgcagatttgagaatgaacatg
caaaagactatgcaggaacacgctgctgtgtttaggactggtacagtgttagctgaaggc
tgccgaaagattgatgatatttacagccagacagaagacctcaagttgtttgatcgtgga
atggtgtggaacacagatctggttgaaacgctcgaactacaaaatctcctcatcaactgc
aaacagactctttatggagccgaggctcgtaaggaaagtcgtggtgcacatgctcgagag
gatttcaaggagcgtattgatgagtacgactactctaagccgctggaaggtcaaacaaac
cgtccttttgacagtcactggagaaaacacaccttggcctggactgaaccgaatacggga
gagacaaccttggattatcgcggtgttatcgatgaaactctggatcaaaaagattgtgcc
tctgtccccccggcagttcgttcttactaa

DBGET integrated database retrieval system