KEGG   Stylophora pistillata: 111346582Help
Entry
111346582         CDS       T05774                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
spis  Stylophora pistillata
Pathway
spis00010  Glycolysis / Gluconeogenesis
spis00562  Inositol phosphate metabolism
spis01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spis00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111346582
   00562 Inositol phosphate metabolism
    111346582
Enzymes [BR:spis01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     111346582
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     111346582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 111346582
NCBI-ProteinID: XP_022809597
LinkDB All DBs
Position
Unknown
AA seq 471 aa AA seqDB search
MVVTVSKVIICVVFFALLGCVVNGRESKPSKKTWLKSGSKTRYQKKEFPFEAPEGCDPLH
ISMVIRHGTRYPSKKDVKKIERMLDVINKEIDPKWSNGDLYLPWKNPFSLDHDKLLASAG
EEELYYLAKEFLKRFPSLLSHPYHPQNFDFISTGTSRTVQSAMAFAFGLFEGRGRLGPSG
FQPVAIASRETNNDPILRFFDICPKYNVEVADNDTALHEYKKFKRGKEVERIGHKLSRLM
TTAPDYSQTTFTAETIIGMYTACIFEVAIFNRESTWCLLFDEEDFLTLEYISDLKHYWKR
GYGYPITYQIGCPLLENIVSNLKNATDPYSGERKYGNFMFAHSETLQPLYALLGLFKDQE
ELRAGNMNAHSRRKYRTSEIVPFGANIAFIAYSCNADDTRGKESDSYKMEQFKIQVFVNE
ELVALPCCGEQRECPLKTFLQCFDTRPNGSCNLSSLCRLESNTAENLHREL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgactgtttcgaaagtgatcatatgtgtggttttctttgcactactaggatgt
gttgtcaatggaagagagagtaagccttcgaagaagacttggctgaaatctggatcaaaa
acccggtatcaaaagaaagagtttccgtttgaagcgcctgaaggttgcgatcctcttcac
atcagcatggtcataagacatggaacacgctatcccagcaaaaaagacgtgaaaaaaatc
gaaagaatgcttgatgtgatcaacaaggaaatcgatccaaagtggtctaatggagatcta
tatcttccctggaaaaatcctttttctctcgatcatgacaagcttttggcatccgctggg
gaagaagaattgtattatctcgccaaagaatttctgaaacgttttccaagtttactatca
cacccatatcatccgcagaacttcgattttatcagtacgggaacttctaggacagtacag
agtgctatggcctttgcgtttggtttgttcgaggggcgagggaggctgggtccaagtggt
tttcagcctgtggcaatcgcgtcgagagaaactaacaatgatcctatacttcgctttttt
gatatctgcccaaagtacaatgtagaagttgcagataatgacactgcacttcatgagtat
aaaaagtttaaacgtggtaaagaagtagaacgtattggtcataaattatcacggctcatg
acaactgctcctgattattcccagacaactttcacagcagaaaccatcattggaatgtac
actgcttgcatttttgaagttgcaatctttaacagggaaagtacttggtgcctccttttt
gatgaggaagatttcttgactctagagtacatatcagacttaaaacattattggaagaga
ggctatggatacccaataacctatcaaattggttgccctttgttggaaaacattgtaagc
aaccttaaaaatgcaacagatccatattcaggtgagagaaagtatggcaattttatgttt
gcccacagtgagactctgcaaccactttatgcattgcttggattatttaaggatcaggag
gagctgagggctggcaacatgaatgcacactctaggcgcaaatacagaactagtgaaatt
gtgccatttggggcaaacattgcattcattgcatatagttgcaatgcagatgacaccagg
ggtaaggaatcagatagttacaaaatggagcaattcaaaatccaagtatttgttaatgaa
gagttggtagctttgccttgttgtggtgaacagagagagtgccccctaaaaacatttttg
cagtgttttgacactagaccaaatgggtcatgcaacctgtcatctttatgccgcctggaa
agcaatactgctgaaaaccttcatagggaactgtga

DBGET integrated database retrieval system