KEGG   Spiribacter sp. UAH-SP71: SPICUR_08155Help
Entry
SPICUR_08155      CDS       T02888                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
spiu  Spiribacter sp. UAH-SP71
Pathway
spiu00020  Citrate cycle (TCA cycle)
spiu00270  Cysteine and methionine metabolism
spiu00620  Pyruvate metabolism
spiu00630  Glyoxylate and dicarboxylate metabolism
spiu00680  Methane metabolism
spiu01100  Metabolic pathways
spiu01110  Biosynthesis of secondary metabolites
spiu01120  Microbial metabolism in diverse environments
spiu01130  Biosynthesis of antibiotics
spiu01200  Carbon metabolism
Module
spiu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spiu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
spiu_M00012  Glyoxylate cycle
spiu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:spiu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPICUR_08155
   00620 Pyruvate metabolism
    SPICUR_08155
   00630 Glyoxylate and dicarboxylate metabolism
    SPICUR_08155
  09102 Energy metabolism
   00680 Methane metabolism
    SPICUR_08155
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SPICUR_08155
Enzymes [BR:spiu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     SPICUR_08155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: AGY92585
UniProt: U5T573
LinkDB All DBs
Position
complement(1649951..1650931)
Genome map
AA seq 326 aa AA seqDB search
MKTPVRVAVTGAAGQIGYSLLFRIASGDMLGPDQPVILQLLEVPPAMDAVQGVMMEIDDC
AFPLVAGLQASDKPEETFQDADYILLVGAKPRGPGMERKDLLEANAAIFSAQGQAMNAVA
SRDVRVLAVGNPANTNALIARHNAPDLDPRSFTAMTRLDHNRALAQLANRTGSHVTGIER
LTVWGNHSATQYPDVTHAVVDGKAAGELVDQSWLEESFIPTVQQRGAAIIKARGQSSAAS
AASAAIDHMRDWTLGTSGDDWVSMAIPSDGSYGITEGLIYSFPVRCVDGRYEIVQGLEID
AFSRERMSATEQELIEERDAVKHLLP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaagacacctgtacgtgtagcggtcaccggcgcagccggccagatcggttatagcctt
ttgttccgcattgcctcgggcgacatgctcgggcccgatcagccggtgatcctgcagctc
ctcgaggtgccgcccgccatggatgccgtgcagggcgtcatgatggagatcgacgactgc
gcgtttccgctggtcgcggggctccaggccagtgataagcccgaggagacgttccaggat
gccgattacatcctcctcgtcggtgcgaagccgcgcggaccggggatggagcgcaaggac
ctcctcgaggccaacgccgcgatcttctcggcgcaggggcaggcgatgaatgcggtggcg
agccgcgatgtgcgcgtcctcgcggtgggtaatccggccaataccaacgccctgatcgca
cggcataacgcgccggatctcgatccgcgctcgttcacggcgatgacccggctggatcat
aaccgggcgctggcgcagctcgccaaccgcacgggcagccatgtcaccgggatcgagcgc
ttgacggtctggggcaatcactcggccacacagtacccggatgtgacccatgcggtggtg
gacggcaaggcggcgggcgagctcgtcgaccagagctggctcgaggagagcttcatcccc
acggtccagcagcgcggtgccgccattatcaaggcgcgtggccagtccagtgccgcctcg
gccgccagtgccgccatcgaccacatgcgcgactggaccctcgggacgagcggcgatgac
tgggtgagtatggcgatcccctcggatggtagctatggcattaccgagggcctgatctac
tcctttccggtccgctgcgtcgacgggcgctacgagatcgtccaggggcttgagatcgat
gccttctcacgcgagcgcatgagcgcgaccgagcaggagctcatcgaggagcgggacgcg
gtcaaacacctgttgccctga

DBGET integrated database retrieval system