KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy1011Help
Entry
MGAS2096_Spy1011  CDS       T00357                                 

Gene name
pstB
Definition
(GenBank) Phosphate transport ATP-binding protein pstB
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
spj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:spj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MGAS2096_Spy1011 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spj02000]
    MGAS2096_Spy1011 (pstB)
Enzymes [BR:spj01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     MGAS2096_Spy1011 (pstB)
Transporters [BR:spj02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    MGAS2096_Spy1011 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_15 AAA_22 RsgA_GTPase AAA_23 AAA_16 NB-ARC AAA_18 AAA_30 AAA_33 ABC_ATPase ATPase_2 AAA_5 AAA_PrkA NACHT Adeno_IVa2 Rad17 cobW G-alpha AAA_25
Motif
Other DBs
NCBI-ProteinID: ABF36063
UniProt: Q1JBJ5
LinkDB All DBs
Position
complement(974756..975517)
Genome map
AA seq 253 aa AA seqDB search
MMTESILQIRDLSVYYNQKKTLKDVSLDLYPNEITALIGPSGSGKSTLLRSINRMNDLNP
EVTITGSIVYNGHNIYSPRTDTVDLRKEIGMVFQQPNPFPMSIYENVVYGLRLKGIRDKS
ILDHAVESSLKGASIWNEVKDRLHDSAVGLSGGQQQRVCIARVLATSPRIILLDEPTSAL
DPISAGKIEETLLLLKKDYTLAIVTRSMQQASRLSDRTGFFLEGDLLECGPTKAMFMNPK
RKETEDYISGKFG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgatgacagaatctattttacagatcagagacctttctgtttactacaatcaaaagaaa
acgttaaaagatgtctctttggacctttatccaaatgaaataacagctttaattggtcct
tctggatctgggaaatcaacgctcttgcgttctatcaaccgtatgaatgatttgaatcct
gaagtaaccattacaggctctatcgtctataacggacacaatatttatagtccaaggaca
gatacggttgatttacgcaaagaaattggtatggtattccaacaacccaacccatttccg
atgtctatttatgagaacgtggtttacggccttcgcttaaaaggtatcagagataaatca
atcttagaccatgctgttgaaagctctcttaaaggggcttccatttggaatgaagtcaaa
gatcgtttacatgattctgcggttggcttatcaggcggacagcaacagagagtttgcata
gctagagttcttgctaccagccccagaataatccttttagatgaacctacctcagctctt
gatcctatctcagctgggaaaattgaagaaacattattgttattaaaaaaagattataca
ctggctattgtgacccgctcaatgcagcaagcctcacgtttatcagatcgaacaggtttt
ttcttggagggtgacttacttgagtgtggtcctacaaaagccatgtttatgaatcctaag
cgcaaagaaaccgaagactatatttctggtaaatttggttga

DBGET integrated database retrieval system