KEGG   Streptococcus pyogenes MGAS9429 (serotype M12): MGAS9429_Spy0434Help
Entry
MGAS9429_Spy0434  CDS       T00358                                 

Gene name
vicR
Definition
(GenBank) two-component response regulator
  KO
K07668  two-component system, OmpR family, response regulator VicR
Organism
spk  Streptococcus pyogenes MGAS9429 (serotype M12)
Pathway
spk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MGAS9429_Spy0434 (vicR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:spk02022]
    MGAS9429_Spy0434 (vicR)
Two-component system [BR:spk02022]
 OmpR family
  VicK-VicR (cell wall metabolism)
   MGAS9429_Spy0434 (vicR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ABF31622
UniProt: Q1JMX7
LinkDB All DBs
Position
431403..432113
Genome map
AA seq 236 aa AA seqDB search
MKKILIVDDEKPISDIIKFNLTKEGYDIVTAFDGREAVTIFEEEKPDLIILDLMLPELDG
LEVAKEIRKTSHVPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRRTE
TIETAVAEENASSGTQELTIGNLQILPDAFVAKKHGQEVELTHREFELLHHLANHMGQVM
TREHLLEIVWGYDYFGDVRTVDVTVRRLREKIEDTPSRPEYILTRRGVGYYMKSYD
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatacttattgtggatgatgaaaaaccgatttctgacattattaagtttaat
ttgacaaaagaaggttatgacattgttacagcttttgatggacgcgaagcggtaacaatt
tttgaagaagaaaagccagatttaattattcttgatttgatgctccctgagttggacggt
cttgaagtagccaaggaaattcgtaaaaccagtcatgtcccgattattatgttgtcggct
aaagatagtgagtttgacaaggttattggacttgaaattggggctgatgattacgtgacc
aagcccttttctaatcgggaattgctggcacgtgtcaaggctcatctgcgtcgtaccgaa
actattgaaacggctgttgcagaagaaaatgcttcttcaggtacacaggaactaaccatt
ggtaatttacagattttaccagatgcgtttgttgctaaaaaacatggtcaagaggtagag
ttgacccatcgtgaatttgaactattgcatcatctagctaaccatatgggtcaggtgatg
acacgagaacacttattggaaattgtttggggatatgattattttggcgatgtgcgcacg
gttgatgtgactgttcgtcgtctccgtgaaaaaattgaagacacaccaagtcgtcctgag
tatattttaacaagacgtggtgttgggtactacatgaaatcttatgactag

DBGET integrated database retrieval system