KEGG   Sphingomonas sp. KC8: KC8_02890Help
Entry
KC8_02890         CDS       T04987                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
spkc  Sphingomonas sp. KC8
Pathway
spkc00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:spkc00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    KC8_02890
Enzymes [BR:spkc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     KC8_02890
Transporters [BR:spkc02000]
 Other Transporters
  Pores ion channels [TC:1]
   KC8_02890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C Glutaredoxin DGOK
Motif
Other DBs
NCBI-ProteinID: ARS26238
UniProt: A0A1X9YBN4
LinkDB All DBs
Position
590992..591663
Genome map
AA seq 223 aa AA seqDB search
MWQLFQFPLCPFSRKVRLVLGEKAVGYELVRESPWTQRDEFLDMNPAGQTPVMADDAAGI
VLIDSSTICEYFEETIEKATMLPGTAANRAEIRRLVAWFDERMYAEVVAPLMHERMLKRI
VHRMTPDAKALREAMKAANGHLDYVDYLLDHRRWIGGPVLSLADLTAAAHLSVADYLGGI
DWRGHDRTKEWYAALKSRPSFRPLLSERMEIVSPPDHYDKVDF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagctctttcaattcccgttatgccccttttcgcgcaaggtccgtctggtcctg
ggggagaaggctgtcggctatgaactggtccgcgaatcgccgtggacccagcgggacgag
tttctcgacatgaaccccgcgggccagacgccggtaatggccgacgacgcggccggaatc
gtgctgatcgattcctccacgatctgcgaatatttcgaagaaaccatcgagaaagcgacg
atgctgcccggcaccgccgccaatcgcgccgaaattcgcaggctcgtcgcctggttcgac
gaacgtatgtatgccgaagtggtggcgccgctgatgcacgaacggatgctgaaacggatc
gttcaccgcatgacgcctgacgccaaggcgctgcgcgaggcgatgaaagccgccaatggc
caccttgattatgtcgattacctgctggaccaccgtcgctggatcggcgggccggtgctc
agcctcgccgatctgacggccgccgcgcatctatccgtggccgattatctcggcgggatc
gactggcgcggccacgaccggacgaaggaatggtacgcagccctgaaatcgcgccccagc
ttccggcccttattgtccgaacggatggagatcgtcagtccgcccgatcattatgacaag
gtggatttctga

DBGET integrated database retrieval system