KEGG   Sphingomonas sp. KC8: KC8_09110Help
Entry
KC8_09110         CDS       T04987                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
spkc  Sphingomonas sp. KC8
Pathway
spkc00473  D-Alanine metabolism
spkc00550  Peptidoglycan biosynthesis
spkc01100  Metabolic pathways
spkc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:spkc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    KC8_09110
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KC8_09110
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    KC8_09110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:spkc01011]
    KC8_09110
Enzymes [BR:spkc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     KC8_09110
Peptidoglycan biosynthesis and degradation proteins [BR:spkc01011]
 Precursor biosynthesis
  Amino acid ligase
   KC8_09110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ARS27447
UniProt: A0A1X9YF68
LinkDB All DBs
Position
complement(1908393..1909316)
Genome map
AA seq 307 aa AA seqDB search
MSVKPLHVAVLMGGWSSERDVSLTSGKGVADALESLGHQVTRIDMGRDVAQRLHDAKPDV
VFNALHGTPGEDGTIQGLLDIMGLKYTHSGLATSVIAIDKQLTKHELVPHGVRMPAGVVV
QSDSLYASDPLPRPYVLKPINEGSSVGVAIVTADGKYGNPIARDSEGPWQHFDQLLAEPF
IRGRELTVAVLGDRALAVTELCPKSGFYDYDAKYTDGLTVHVCPAEIPDDIAEAAKAMAL
KAHQLLGCKGTSRSDFRWDDEQGEAGLYLLEVNTQPGMTPLSLVPEQARYIGLGYADLVQ
RIVEDAL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtgaagcccctgcatgtcgcggtgttgatgggcggttggtcgtccgaacgcgac
gtgtctttgacgtccggcaagggcgtcgccgacgcgctggaatcgcttggccaccaggtc
acgcggatcgatatgggccgcgatgtcgctcagcgcctgcatgacgcaaagcccgacgtg
gtgttcaacgcgctccacggcacgcccggcgaagacggcaccattcagggcctgctcgat
atcatggggctgaaatatacccatagcggccttgcgacatcggtgatcgcgatcgacaag
caactgaccaagcatgaactggtgccgcatggcgtgcggatgccggccggcgtggtcgta
caatccgacagcctgtatgctagcgatccgctgccgcgcccatatgtgctgaaaccgatc
aacgaaggatcgtcggtcggcgtcgccatcgtcacggccgatggcaagtacggcaacccg
attgcgcgcgacagcgaagggccgtggcagcatttcgatcagttgctggccgaaccgttc
atccggggccgcgaattgacggtggcggtgctgggcgatcgggcgctggcggtgaccgaa
ttgtgccccaaaagcggcttttacgattatgacgccaaatataccgatggcctgaccgtc
cacgtctgcccggctgaaatccccgatgatattgccgaagccgccaaggcgatggcgctg
aaggcgcatcagttgctggggtgcaagggcacgtcgcggtccgatttccgctgggatgac
gaacagggtgaagctggcctctatctgctggaagtgaacacccagccgggtatgacgccc
ttgagcttggtgcccgaacaggcgcgctatatcggccttggctatgccgatctggtgcag
cggatcgtggaggatgccctatga

DBGET integrated database retrieval system