KEGG   Sphingomonas sp. KC8: KC8_14845Help
Entry
KC8_14845         CDS       T04987                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
spkc  Sphingomonas sp. KC8
Pathway
spkc00620  Pyruvate metabolism
spkc00680  Methane metabolism
spkc01100  Metabolic pathways
spkc01120  Microbial metabolism in diverse environments
spkc01200  Carbon metabolism
Module
spkc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:spkc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KC8_14845
  Energy metabolism
   00680 Methane metabolism
    KC8_14845
Enzymes [BR:spkc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     KC8_14845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase Imm2
Motif
Other DBs
NCBI-ProteinID: ARS28556
UniProt: A0A1X9YIF9
LinkDB All DBs
Position
complement(3105053..3107743)
Genome map
AA seq 896 aa AA seqDB search
MTASAPITQNPDIRFLGRLLGDVIRAYGGEALFRRIEYIRSASVDRHRGIGAADAVDPGL
DALSLDDTLAFVRGFMLFSMLANLAEDRQGIAVEPGADVAQALARLEAEGIGKDRAQALL
AEALVAPVLTAHPTEVRRKSIIDHRNRIAELMALRDMGRTETDNGELVDEAIYRQIALLW
QTRPLRRERLYVADEVETALAYLRDIFLPVIPALHARWERALGQRPASFLRPGSWIGGDR
DGNPNVTADSLRLALGRSGEAVLAHYLDLLHGLGAELSISTELADVTADVLALAERGGDN
AASRSDEPYRRAITGIYARLAATYRVLVGRAPPRPASFAAEPYADPAALRADLAAIAHAL
ATSGKGALSGGGGLGRLIRAVETFGFHLATLDLRQNADVHERVVAELLRVAGVAADYRAL
DENARVALLRRELANARPLASPYAAYSAETASELAIAHAAAEAHARYGPAAITTYIISKA
ESVSDLLEVHILLKEAGLYRPGSVDDGAPPSAAIMVVPLFETIGDLEAAAEVMTAWFGLP
EAAAITGTRGHQEVMVGYSDSNKDGGYLTSAWSLHQASRALAPVFAKAGAAMQLFHGRGG
AVGRGGGSSFAAIRAQPPGTVAGRIRITEQGEVIAAKYGTRESAVANLEAMASATLLASL
EPPQLAERDYARFASAMTRLSGTAFRAYRDLVYDTDGFRSFFRQLTPIAEIADLKIGSRP
ASRTQGDRIEDLRAIPWVFSWAQARVMLPGWYGVGQAIDRFDDPGLLREMVDGWPFLQAT
LANLEMVLAKSDMGLAGHYVALVEDRAVGQAIFGRIRDGWHRTRDGLLAITQQSRLLERN
PALDHSIRLRLPYIEPLNHLQIELLKRHRAGEDDPRIREGIQLSINAIATALRNSG
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atgactgcttccgccccgatcacgcagaacccggacattcgctttctcggccgcctgctc
ggcgatgtcatccgcgcttatggcggcgaagccctgttccgccggatcgaatatatccgg
tccgcatcggtggatcgccatcgcggcattggggcggccgatgcggtggacccgggcctc
gatgcgctcagccttgatgacaccctggccttcgtgcgcgggttcatgctgttttcgatg
ctcgccaaccttgccgaagatcgtcagggcatcgccgtcgagccgggcgccgatgtcgcg
caggcgctggcccggctggaagcggaagggatcggcaaggatcgcgcccaggccctgctg
gccgaagcgctggtcgccccggtgctgaccgcgcaccccaccgaagtgcgccgcaaatcg
atcatcgatcatcgcaaccgtatcgccgaactgatggcgcttcgcgatatgggccgcacc
gaaaccgacaatggcgaattggtggacgaagccatctatcgccagatcgccttgctctgg
caaacccggccgctgcgccgcgaacggctctatgtggcggacgaggtggaaaccgcgctc
gcttatctgcgcgatatcttcctgccggtgatccccgcgctccacgcccgctgggaacgc
gcgctcggccagcgcccggccagctttctgcgtcccggcagctggatcggcggcgatcgc
gacggcaatcccaacgtaacagcggattcattgcggctggcgctcggccgatccggcgaa
gcggtgctcgcgcattatctcgacctgcttcacgggctgggcgccgaactgtcgatttcg
accgaactggccgacgtcacggccgatgtgctggcgctggccgaacgcggcggcgataac
gccgccagccgcagcgacgaaccctatcgccgcgcgatcaccggcatctatgcgcggctg
gccgccacctatcgcgtgctggtcgggcgggcgccgccgcgtcccgcctcgttcgcggcc
gaaccctatgccgatccggcggccttgcgcgccgatctcgccgcgatcgcccatgcactg
gcgacaagtggcaagggcgcgctttcaggcggcggcgggcttggtcggctgatccgcgcg
gtcgaaaccttcggctttcacctcgccacgctcgatctgcgccagaatgccgacgtccat
gaacgggtggttgccgaactgctccgggttgccggggtggcggccgattatcgtgcgctg
gacgaaaatgcccgcgtcgccctgctccgccgcgaactggcgaacgcgcggccactggcc
agcccctacgctgcctattcggccgaaaccgcatccgaactggcgattgcccacgccgcc
gccgaagcccacgcccgctacggcccggccgcgatcaccacctatatcatttccaaggcg
gaaagcgtgtcggacctcttggaagtccacatcctgctgaaggaagccgggctgtaccgc
cccggcagcgtggatgacggcgccccgcccagcgccgcgatcatggtggtgccgctgttc
gaaacgatcggcgatctcgaagccgcagccgaggtcatgaccgcatggttcgggctgccc
gaggcggccgcgatcaccggcacgcgcggccatcaggaggtgatggtcggctattcggat
tcgaacaaggatggcggctacctgacttcggcatggagcctccatcaggccagccgcgcg
ctggccccggtattcgcaaaggccggcgcggcgatgcagttgttccacggccggggcggc
gccgtcgggcgcggtggcggttcgtccttcgcggcgatccgcgcgcagccacccggcacc
gtcgccggccgcatccgcatcaccgaacagggcgaggtgatcgccgccaaatatggcacg
cgcgaaagcgccgtcgccaatctcgaagcgatggcatcggccaccctgctcgccagcctt
gaaccgccgcaactggccgaaagggattatgcgcgctttgccagtgcgatgacgcggctg
tccggcaccgcgttccgcgcctatcgcgatctcgtttatgataccgatggttttcgcagc
ttcttccgccagttgacgccgatcgccgaaatcgcggacctcaagatcggatcgcgcccc
gccagccgcacgcaaggcgaccggatcgaagatctgcgcgccatcccgtgggtcttttcc
tgggcgcaggcacgggtgatgctgcccggctggtatggcgtcgggcaggcgatcgaccgc
ttcgacgatccgggcttgctgcgtgaaatggtcgatggctggccgttcctgcaggcgacg
ctggcaaatctggaaatggtgctcgccaaatccgacatgggactggccggccattatgtc
gcgctggtcgaagacagggccgtcgggcaggcgattttcggccgtatccgcgatggctgg
cacaggacgcgcgatggcctgctggcgatcacgcagcagagccgcctgctcgaaaggaat
cccgcgctcgaccattcgatccggctgcggctgccctatatcgagccgctcaaccatctg
cagatcgaactgctcaagcgtcatcgcgccggcgaagatgatccgcgcatccgcgaaggc
atccagctttcgatcaacgccatcgccaccgcattgcgcaacagcgggtag

DBGET integrated database retrieval system