KEGG   Shewanella pealeana: Spea_0747Help
Entry
Spea_0747         CDS       T00606                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
spl  Shewanella pealeana
Brite
KEGG Orthology (KO) [BR:spl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Spea_0747
Enzymes [BR:spl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Spea_0747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored AlaDh_PNT_C DAO Thi4 NAD_binding_7 NAD_binding_8 Glutaredoxin FMO-like FAD_binding_3 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ABV86074
UniProt: A8H0I7
LinkDB All DBs
Position
923915..925489
Genome map
AA seq 524 aa AA seqDB search
MLDANVKNQLNTYLQNLKHPVELVVSIDDSKKAQELKSLATDIDSLSSLISVTDQVGERT
PSMSVINPQLNSKITFAGLPMGHEFTSLVLALLHSGGHPIKLEADVIEQIRQLPGEYRFE
TYVSLSCQTCPEVVQALNMMAAINPNITNVMIDGSLFQDEVNERNIMAVPSVYLNGEQFS
MGAISTVEILNKLDVNAAGRKAEQLNEKEPFEVLVIGGGPAGASAAIYAARKGLRTGIVA
DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVHEYDVDIMNNQRALSLKSGELFELE
LENGAVLRSKTVLLATGARWREMNVPGEQEYRGSGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDSSLRADEVLQRKAKSMGNIDIITQAMTTEVTGDGKRVNG
LNYTDRATGESHHVELAGIFVQIGLVPNSEWLKDTIDMTARGEIIVDGKGETSVPGIFAA
GDVTNSAYKQIIIAMGSGATASLGAFDYLIRHDIDESAGGNIAA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaaacgtaaagaatcaactgaacacttatttgcagaacctcaagcatcca
gttgagctggttgtttctattgatgacagtaaaaaagctcaagagcttaagtcgttagct
acggatatcgatagcctgtcttcacttatctctgtaacagatcaagtcggcgagcgtacg
ccatcaatgtcggtaattaacccgcaattgaatagcaaaattacttttgcaggcctgcct
atgggtcatgagtttacctctttggtacttgcgcttctgcacagtggcggccacccaatc
aagcttgaagccgatgtgattgagcaaattcgtcagctaccgggtgagtatcgcttcgag
acctacgtctctctaagttgtcagacttgccctgaagtggttcaggcgctgaacatgatg
gcggcaattaacccaaatatcactaacgtgatgatcgacggatcactgttccaagacgaa
gtgaatgagcgcaacatcatggcggtgccatctgtgtacttaaatggtgagcagttctca
atgggcgctatcagcacggttgagatcttaaataagcttgatgtaaacgcagcaggtaga
aaagccgagcagctaaacgagaaagagccattcgaagtattagtaattggcggtggccca
gcgggggcatcggcggcaatctacgcggcacgtaaaggtctgcgcaccggtattgtagca
gacaagtttggtggtcaggttgctgaaactgttggcattgagaacttcatctctgttaaa
gcgaccgaaggtccaaagctggtggcaaatcttgaagcccacgtacatgaatatgatgtc
gatatcatgaacaaccagcgtgccttaagccttaagtctggtgagttattcgaactggaa
ctagaaaatggcgcggtactgcgcagcaaaacagtattgctagcaaccggtgctcgttgg
cgtgaaatgaacgtgccaggtgagcaagaatatcgcggcagtggcgttgcatactgccca
cactgtgatggtccactgttcaaaggcaagcgcgttgcggtgataggtggcggtaactca
ggaatcgaagcggcaatcgatttagccaatattgttgaacacgttactgtgcttgagttt
gatagcagtctacgcgccgatgaagtgttgcagcgcaaagctaagtctatgggcaatatc
gatatcatcacccaagcaatgacaaccgaggtcactggcgatggtaagcgcgttaacggc
cttaactataccgacagagcgacaggcgaaagccatcatgttgagcttgctggaatattt
gtgcagataggtttagtacccaactctgagtggcttaaagacactatcgatatgacggcg
cgcggcgaaatcattgtcgacggcaaaggcgagacctctgtgccgggtatttttgcggcg
ggtgatgtgactaactcggcctacaaacagatcatcattgccatgggcagcggagcaacc
gcatcgttaggcgcatttgattacttaattcgtcacgatatcgatgagtcggcgggtggc
aatattgctgcctag

DBGET integrated database retrieval system