KEGG   Shewanella pealeana: Spea_1963Help
Entry
Spea_1963         CDS       T00606                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
spl  Shewanella pealeana
Brite
Enzymes [BR:spl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Spea_1963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABV87285
UniProt: A8H3Z8
LinkDB All DBs
Position
complement(2388916..2389500)
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKNALEPHISEETINFHYGKHHNTYVVKLNGLVEGTELEQKSLEEIIKTS
TGGIFNNAAQIWNHTFYWNCLSPNGGGEATGPVAEAIIAAFGSFEAFKAQFTDSAVNNFG
SAWTWLVKNADGTVAIVNTSNAATPLTDEGVTPIMTVDVWEHAYYIDYRNVRPDYLAHFW
QLVNWDFVNANFAA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattaccagcattaccttacgcaaagaacgcacttgagccacacatctcg
gaagaaacaattaactttcattacggtaagcaccacaacacttacgttgttaagcttaac
ggtttagttgaaggtactgaacttgagcaaaagagcctagaagagattattaaaacctct
actggtggtatctttaacaacgcagctcaaatctggaatcacactttctactggaactgt
ctatcaccaaatggtggaggtgaagcaactggtcctgtagcagaagctatcattgctgca
tttggctcatttgaagcatttaaggcacagttcactgattctgcagtaaacaacttcggt
agcgcttggacatggcttgtcaaaaatgcagacggcactgtcgctattgttaatactagc
aacgctgcaacacctcttacagatgaaggcgtgacgccaatcatgactgttgacgtgtgg
gaacacgcttactacatcgattaccgtaacgtacgcccagactatctagctcacttttgg
caattagttaactgggattttgtgaatgcaaacttcgcagcttaa

DBGET integrated database retrieval system