KEGG   Shewanella pealeana: Spea_2494Help
Entry
Spea_2494         CDS       T00606                                 

Definition
(GenBank) 3-oxoacyl-(acyl-carrier-protein) reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
spl  Shewanella pealeana
Pathway
spl00061  Fatty acid biosynthesis
spl00780  Biotin metabolism
spl01100  Metabolic pathways
spl01130  Biosynthesis of antibiotics
spl01212  Fatty acid metabolism
Module
spl_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:spl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Spea_2494
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Spea_2494
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Spea_2494
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:spl01004]
    Spea_2494
Enzymes [BR:spl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     Spea_2494
Lipid biosynthesis proteins [BR:spl01004]
 Fatty acid synthase
  Component type
   Spea_2494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_10 MTS DUF1776 LDcluster4 THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: ABV87814
UniProt: A8H5H7
LinkDB All DBs
Position
complement(3039750..3040496)
Genome map
AA seq 248 aa AA seqDB search
MSISFDLTGKVALVTGASRGIGRAVAETLVSAGAVVIGTATSERGAEAIQAYLGDKGHGL
VLNVTDADSVKALFETIKQRAGDVDILVNNAGITRDNLLMRMKDDEWNDILDTNLTSIFR
TSKAVMRPMMKKRHGRIINIGSVVGTMGNAGQTNYSAAKAGLIGFTKSLAREVASRQITV
NAIAPGFIQTDMTDELTEDQQQAIMSQVPMERLGQAQEIAHAVLFLASDSAAYITGETLH
VNGGMYMV
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagtataagttttgatttgactggtaaagtagccttagttacaggcgctagccgtggt
attggacgcgcagttgctgaaacattagtttcagctggcgcagtcgtcatcggtaccgcg
accagtgagcgtggggcagaagcgattcaagcctatttaggtgataagggccacggtcta
gttttaaacgtaacagacgcagactctgtaaaagcattgtttgaaacgatcaaacaaaga
gctggtgatgttgatattttagtcaacaacgcaggtatcacacgtgataatttgttaatg
cgaatgaaagatgacgaatggaatgatatcctagatactaacctaacatctatcttccgc
acctcaaaagcggtgatgagaccaatgatgaaaaagcgtcatggacgtattatcaatatt
ggctcagttgtaggtacaatgggtaatgcagggcagacaaactactctgcagctaaagcg
ggtctgattggatttacaaaatctcttgcaagagaggttgcatctcgtcagattacagtt
aatgctattgcccctggatttatccagacagatatgacggatgagctgacggaagaccag
caacaagctattatgtctcaggtaccaatggaaagacttggtcaggcgcaggaaattgct
cacgcagtcctctttttagcgtcggactctgctgcttacattacgggagaaactctccac
gttaatggtggcatgtacatggtttaa

DBGET integrated database retrieval system