KEGG   Shewanella pealeana: Spea_2588Help
Entry
Spea_2588         CDS       T00606                                 

Definition
(GenBank) Chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
spl  Shewanella pealeana
Pathway
spl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spl01100  Metabolic pathways
spl01110  Biosynthesis of secondary metabolites
spl01130  Biosynthesis of antibiotics
spl01230  Biosynthesis of amino acids
Module
spl_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:spl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spea_2588
Enzymes [BR:spl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     Spea_2588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt ChaB
Motif
Other DBs
NCBI-ProteinID: ABV87908
UniProt: A8H5S1
LinkDB All DBs
Position
complement(3151216..3152310)
Genome map
AA seq 364 aa AA seqDB search
MSGNSIGQNFVVTTFGESHGVAIGCIIDGCPPGVELTEADMQHDLDRRRPGTSRYTTARR
EPDEVRILSGVFEGETTGTSIGLLIENTDQRSKDYSNIKDLFRPGHADYTYQQKYGQRDY
RGGGRSSARETAMRVAAGAVAKKYLKQVHGVEIHAYLSQLGPIAAETVDFDQIEQNAFFF
PDATKLDSLDEYMRELKKSGDSIGAKVSVVATGVPVGLGEPVFDRLDADIAHALMGINAV
KGVEIGDGFEVVNQKGSEHRDLMSPAGFASNHAGGILGGISSGQPIIAHIAMKPTSSISV
PGESMNAQGEVAEVITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRHRAQNMDVNSSTPI
IGMR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggaaacagtataggtcaaaatttcgtagtaacaacattcggtgaaagccacggt
gtcgccatcggctgtattatcgacggatgcccaccaggggttgagttgacagaggcggat
atgcagcacgacttagatcgccgccgccctggtacttcacgatatacaactgctcgaaga
gagcctgacgaagtgcgtattctgtccggtgtgtttgagggggaaaccacaggtacctca
attggtttactgattgaaaacaccgaccagcgcagcaaagattattctaatatcaaagat
ttgttccgtccagggcatgccgactacacttaccaacaaaaatacggtcaacgcgactat
cgcggtggcggtcgttcatctgctcgcgaaacggcaatgcgagtcgcagctggcgctgtc
gctaaaaaatacctaaaacaagttcatggcgttgaaattcatgcttatctgtcacagctt
gggccgattgcagccgagactgtcgattttgatcagatagagcaaaatgcctttttcttt
cctgatgccacaaaactggattcactagacgagtacatgcgtgagcttaaaaagagtggg
gactccattggcgcaaaagtgtctgtagtcgcaacgggtgtgccagtgggtcttggtgag
ccagtatttgatcgcttggatgccgatatcgctcatgcgctaatgggcattaatgctgtt
aaaggcgttgagattggtgatggttttgaagtggtgaatcaaaaaggctctgaacataga
gacttgatgtcaccagcaggttttgcctccaatcatgcgggtggcattttaggcgggatc
tcttctggtcagccaattattgcccatattgctatgaagccgacttcgagtattagcgtg
ccgggtgagagcatgaatgctcagggtgaagtcgccgaggttatcactaaagggcgtcac
gatccttgtgtgggtattagagcggtaccaattgccgaagccatgttggctatcgtgctg
atggatcacttattacgtcaccgcgcacaaaatatggatgtgaatagcagtacacctatt
atcggaatgcgttga

DBGET integrated database retrieval system