KEGG   Shewanella pealeana: Spea_2953Help
Entry
Spea_2953         CDS       T00606                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
spl  Shewanella pealeana
Pathway
spl00250  Alanine, aspartate and glutamate metabolism
spl00410  beta-Alanine metabolism
spl00430  Taurine and hypotaurine metabolism
spl00650  Butanoate metabolism
spl01100  Metabolic pathways
spl01110  Biosynthesis of secondary metabolites
spl01120  Microbial metabolism in diverse environments
spl02024  Quorum sensing
Module
spl_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:spl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Spea_2953
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Spea_2953
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Spea_2953
   00430 Taurine and hypotaurine metabolism
    Spea_2953
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Spea_2953
Enzymes [BR:spl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Spea_2953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ABV88270
UniProt: A8H6T3
LinkDB All DBs
Position
complement(3615440..3616834)
Genome map
AA seq 464 aa AA seqDB search
MPLHSKDTVRDDLLDDIYSSSDLALSMPKYKMPEQENNPRHAYQIVHDELMMDGNSRQNL
ATFCQTWVEDEVHQLMDECIDKNMIDKDEYPQTAELEARCVHMLADLWNSPDAENTLGCS
TTGSSEAAMLGGMALKWAWRKKMKALGKPTDKPNMVCGPVQVCWHKFARYWDIELREIPM
EGDRLIMNAEEVIKRCDENTIGVVPTLGVTFTCQYEPVKAVHDALDKLQKETGLDIPMHV
DAASGGFLAPFCQPELEWDFKLPRVKSINASGHKFGLSPLGVGWVIWRDASALDEDLIFN
VNYLGGNMPTFALNFSRPGGQIVAQYYNFLRLGKEGYRKIHQACYDTAQYLSSEIEKLGM
FEIIYDGHDGIPAMSWSLKEGVDPGFNLFDLSDRIRSRGWQIAAYAMPPKREDLVIMRIL
VRHGFSRDQADLLVADLKHCVEFFAEHPISHGSDAKESSGFNHG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcctcttcactcaaaagatactgtgcgagatgacctcttagatgatatctactcatcg
tctgacttagctttatccatgcctaaatataagatgcctgagcaggaaaataatccacgt
catgcatatcaaatcgtacacgacgagctgatgatggacggaaactcccgtcaaaatcta
gcgacattttgccaaacttgggttgaggatgaagttcatcaattgatggacgaatgtatc
gataagaatatgatcgataaagatgagtaccctcaaactgcagagcttgaagcccgttgc
gtgcatatgcttgccgacctttggaactctcccgacgctgaaaataccttaggctgctca
accactggctcgagtgaggctgcgatgctcggtggtatggcattgaaatgggcttggcgt
aagaagatgaaagcgttaggtaaaccaacggataaacccaatatggtttgtggaccggtg
caagtttgctggcataaattcgcgcgctattgggatatagagttacgtgagatcccgatg
gaaggcgatcgtttaatcatgaatgctgaagaagtgattaagcgctgcgatgaaaatacc
ataggtgttgtaccgactttaggggtgacgttcacctgtcagtacgagcctgtaaaggcg
gtacatgatgcgctcgataagttgcaaaaagagactggactggatattccaatgcatgtt
gatgccgccagtggaggcttcttagcgccattttgccaaccagaactagaatgggacttt
aaattaccaagggtaaaatcaattaatgcgtctgggcataaatttggcttgagccctctt
ggtgtgggttgggttatttggcgcgatgcgtcggccttagatgaagaccttatttttaat
gtgaactaccttggcggtaacatgccgacctttgcgctgaacttctctcgacctggtgga
cagatagttgcgcaatactacaactttttgcgcttaggtaaagaaggctacagaaaaatc
catcaggcttgttacgacaccgcgcaatacctgtcgagtgagattgagaaactggggatg
ttcgagatcatttatgatggtcatgacgggatccctgcgatgagttggtcgttaaaagag
ggcgttgacccagggtttaacttgtttgatctctctgatcgtatccgttctcgaggctgg
cagattgcggcctatgccatgccgccgaagagagaggatttagtcattatgcgtattctg
gtacggcatgggtttagccgagatcaagcggacttattagtagctgacttgaagcactgt
gttgaattttttgccgaacacccaatttcacatggtagtgatgccaaagagtcgtctggc
tttaatcatggttaa

DBGET integrated database retrieval system