KEGG   Sphingomonas sp. LK11: AV944_03120Help
Entry
AV944_03120       CDS       T04954                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
splk  Sphingomonas sp. LK11
Pathway
splk00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:splk00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AV944_03120
Enzymes [BR:splk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AV944_03120
Transporters [BR:splk02000]
 Other Transporters
  Pores ion channels [TC:1]
   AV944_03120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C_3 GST_C
Motif
Other DBs
NCBI-ProteinID: APX64997
UniProt: A0A1P8PR50
LinkDB All DBs
Position
641086..641757
Genome map
AA seq 223 aa AA seqDB search
MWQLYQFPLCPFSRKVRLLLGEKGVGYELVRESPWQRRDEFLDMNPAGQTPVMVDEERGV
LLVDSMAISEFFEETVEKSAMINGTAVGRAEIRRLVTWFDTHFYQDVTGPLLHERMVKRV
ARTGSPDAKGLREAMKAAVGHLDYTDYLLDHRNWLGGATMSLADLAAAAQISVADYLGGI
DWKGHEQTARWYRGLKSRPSFRPLLSERMEMVTPPSHYDNVDF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaactctaccaattcccgctctgtcccttttcgcgcaaggtccggctgttgctg
ggcgagaagggcgtcggatacgagttggtgcgcgagtcgccatggcagcggcgcgacgag
tttctcgacatgaaccccgccgggcaaaccccggtgatggtcgacgaggagcgcggcgtg
ctgctggtcgactcgatggcgatcagtgagtttttcgaggagacggtcgaaaaatcggcg
atgatcaacggcaccgccgtcggccgcgccgagatccggcggctggtgacgtggttcgac
acgcatttctatcaggacgtgaccggccccttgctccacgaacgcatggtcaagcgcgtc
gcacgcaccggcagccccgatgccaagggtcttcgcgaggcgatgaaggcggcggtcggg
catctcgactataccgattatctgctcgaccatcgcaactggttgggcggggcgacgatg
agtctcgccgatctggcggcggcggcgcagatttcggtcgccgattatctgggcggcatc
gactggaaggggcatgagcagaccgcgcgctggtatcgcgggctgaagagccgcccctcc
ttccgcccgctgctgtccgagcggatggagatggtcaccccgccgtcgcattacgacaat
gtcgacttctga

DBGET integrated database retrieval system