KEGG   Sphingomonas sp. LK11: AV944_06160Help
Entry
AV944_06160       CDS       T04954                                 

Definition
(GenBank) AP endonuclease
Organism
splk  Sphingomonas sp. LK11
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 AP_endonuc_2_N
Motif
Other DBs
NCBI-ProteinID: APX65498
UniProt: A0A1P8PSI5
LinkDB All DBs
Position
1263864..1264934
Genome map
AA seq 356 aa AA seqDB search
MTAAGAPSSAMRGPGIFLAQFMGDAAPFDTLDSAARWMAEAGYEGVQIPTWDARCIDLKL
AAESQDYCDDLAGRCAEAGVAITELSTHLQGQLVAVHPAYDAAFDGFAPEAVRGKPAERQ
LWAVQQLRYAAKASRRLGLSAHATFSGALLWPFVYPWPQRPGGLVAEGFTELGKRWRPIL
DAFEEEGVDLCYELHPGEDLHDGTTFERFLESVGGHQRANILYDPSHFVLQAMDYLQFID
FYHDRIRMFHVKDAEFNPTGRAGVYGSYSDWVDRPGRFRSLGDGQVDFGGIFSKLTQYGY
AGWAVLEWECCLKHPEDGAREGAPFIAAHMIRRPTRAFDDFAGGGDPAANRRWLGL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccgccggagccccctcgtcggcgatgcgcggcccgggcattttcctggcgcag
ttcatgggtgacgccgcgccgttcgacacgctcgactcggcggcgcgctggatggcggag
gcgggttatgagggtgtgcagattccgacctgggacgcgcgctgcatcgacctgaagctg
gctgccgaaagccaggattattgcgacgacctggccgggcgctgtgccgaggcgggtgtc
gcgatcaccgaattgtcgacccatttgcaggggcagctggtcgcggtccatccggcctat
gacgccgcctttgatggcttcgcgccggaggccgttcggggcaagcccgccgagcggcag
ctatgggcggtccagcaattgcgttacgccgccaaggccagtcggcggctgggcttgagc
gcgcatgcgaccttttccggcgcgctgctctggcccttcgtctatccctggccgcagcga
cccggcgggctggtggcggaaggctttaccgagctgggcaagcgctggcgcccgatcctg
gatgcgttcgaggaagagggcgtcgacctctgctatgagctgcatcccggcgaggatttg
cacgacggcacgaccttcgagcggttcctggagtcggtcggcggtcatcagcgcgccaat
atcctctacgaccccagccatttcgtgctgcaggcgatggattatctccagttcatcgac
ttttaccacgaccgaatccgcatgttccacgtcaaggatgccgagttcaacccgaccggt
cgggcgggcgtctatggcagctatagcgactgggtggaccggccggggcgtttccgttcg
ctgggcgacggacaggtggatttcgggggcattttctcgaagctgacccagtatggctat
gccggttgggcagtgctggaatgggaatgctgcctgaagcacccggaagacggcgcgcgg
gagggggcgccctttatcgccgcgcacatgatccgccggccgacacgcgccttcgacgat
ttcgcgggtggcggcgatccggccgccaatcggcgctggctgggactttaa

DBGET integrated database retrieval system