KEGG   Sphingomonas sp. LK11: AV944_10600Help
Entry
AV944_10600       CDS       T04954                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
splk  Sphingomonas sp. LK11
Pathway
splk02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:splk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AV944_10600
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:splk02000]
    AV944_10600
Enzymes [BR:splk01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     AV944_10600
Transporters [BR:splk02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    AV944_10600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_33 AAA_15 AAA_22 AAA_29 AAA_16 PRK AAA_28 Rad17 AAA_18 AAA_24 RNA_helicase NACHT MMR_HSR1 AAA_23 Adeno_IVa2 Mg_chelatase G-alpha NB-ARC
Motif
Other DBs
NCBI-ProteinID: APX66198
UniProt: A0A1P8PUI4
LinkDB All DBs
Position
complement(2317631..2318395)
Genome map
AA seq 254 aa AA seqDB search
MVNTPKITARNVSVSYADKQAIHDISIDVDMDHVIAFIGPSGCGKSTFLRTLNRMNDTIP
SARVSGDVRLDGQDIYAPEMDVVQLRARVGMVFQKPNPFPKSIYENVAYGPRIHGLATSR
SEMDAIVERSLTRAGLWNEVKDRLSESGTALSGGQQQRLCIARAIAVDPEVILMDEPCSA
LDPIATARIEELIHDLRGRYAIAIVTHNMQQAARVSQRTAFFHLGTLVEYGKTSDIFTNP
KEERTKDYITGRYG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
ctggtgaatacccccaagataaccgcgcgcaacgtcagcgtgtcctatgccgacaagcag
gcgatccatgacatctcgatcgatgtcgacatggatcacgtcatcgcgttcatcggcccg
tcgggctgcggcaagtcgaccttcctgcgcacgctgaaccgcatgaacgacaccatcccc
tcggcgcgggtgtcgggtgacgtgcggctggacgggcaggacatctatgcgcccgagatg
gacgtggtgcagctgcgcgcgcgcgtcgggatggtgtttcagaagcccaaccccttcccc
aagtcgatctacgagaacgtcgcctatggcccgcgcatccatggcctggcgacctcacga
agcgagatggatgcgatcgtcgagcgctcgctgacccgtgcgggcctgtggaacgaggtc
aaggatcgcctgtcggaaagcggcaccgcgctgtcgggcggccagcagcagcgactgtgc
atcgcccgtgccatcgccgtcgaccccgaggtcatcctgatggacgagccgtgcagcgcg
ctggacccgatcgcgacggcgcgcattgaggaactgatccacgacctgcgcggccgctat
gccatcgcgatcgtcactcacaatatgcagcaggccgcccgcgtctcgcaacgcaccgcc
tttttccacctcggcaccttggtcgagtacggcaagacgtccgacatcttcaccaacccg
aaggaagagcggacgaaggactatattaccggccgttacggctga

DBGET integrated database retrieval system