KEGG   Sphingomonas sp. LK11: AV944_17065Help
Entry
AV944_17065       CDS       T04954                                 

Definition
(GenBank) methionine gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
splk  Sphingomonas sp. LK11
Pathway
splk00270  Cysteine and methionine metabolism
splk00450  Selenocompound metabolism
splk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:splk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AV944_17065
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AV944_17065
Enzymes [BR:splk01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     AV944_17065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5 Met_gamma_lyase DegT_DnrJ_EryC1 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: APX67263
UniProt: A0A1P8PXL1
LinkDB All DBs
Position
3695407..3696621
Genome map
AA seq 404 aa AA seqDB search
MSTPAPFGFSTAAIHHGYDPQDHEGALTPPLHLTSTFAFESAEDGAARFSGEAPGHVYSR
ISNPTLDLLERRVAHLEGAEAALGTASGMGAITATLWTLLRPGDEILTDMTLYGCTFAFM
QHGLGRFGIRVTHVDMTDIAAVEAAFGPDTKLVYFETPANPNMRLVDIQAVCALAKAHGA
WSMVDNTYATPVITRPIALGADFVVHSATKYLGGHGDLVAGMVLGRAADIQQVRLFGVKD
MTGAVLSPFNAMLILRGLKTLELRVQRHAASAQAIAERLQAHPAVHAVHYPGLESFPQHD
LARRQMALPGGMIAFQVRGGFEAGKRVMNRLTLIQRAVSLGDAETLIQHPASMTHSTYPV
EQLIAHGIMPDLVRLSVGLEDVRDIWADLGAALDAELGTLSHAA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacccccgcccccttcggtttttcgaccgccgccatccatcatggctatgatccc
caggatcacgagggcgcgctgaccccgccgcttcacctgacctcgaccttcgccttcgaa
agcgcggaagacggcgcggcgcgcttctcgggcgaggcaccgggccatgtctatagccgc
atctccaacccgacgctcgacctgctggaacggcgcgtcgcgcatctggaaggcgccgaa
gcggcgctgggcacggcatcgggcatgggggcgatcaccgcgaccctgtggacgctgctg
cgccccggtgacgaaatcctgaccgacatgacgctttatggctgcaccttcgccttcatg
cagcatgggctgggccggttcggcatccgcgtcacccatgtcgacatgaccgacatcgcc
gcggtcgaggcggcgttcgggccggacaccaagctcgtctatttcgagacgcccgccaat
cccaatatgcggctggtcgatatccaggcggtctgcgccctcgccaaggcgcatggcgcg
tggagcatggtcgacaacacctatgccacgccggtcatcacccgcccgatcgcgctgggt
gccgacttcgtcgtgcactccgccacgaaatatctgggcggacatggcgatctggtggcg
ggcatggtgctgggccgggcggcggatatccagcaggttcggctgttcggcgtgaaggac
atgaccggcgcggtgctgtccccgttcaacgccatgctgatcctgcgcggcctgaagacg
ctggaactccgcgtacagcgtcatgccgcctcggcacaggcgattgccgagcggcttcag
gcgcatccggcggtgcatgcggtccattatccggggctggagagcttcccccagcatgac
ttggcccggcgtcagatggcgctgcccggcggcatgatcgcctttcaggtgcgcggcggg
ttcgaggcgggcaagcgcgtgatgaaccggctgacactgatccagcgcgccgtgtcgctg
ggcgatgccgagacgctgatccagcatcccgccagcatgacccattccacctatccggtc
gaacagctcatcgcgcatggcatcatgcccgatctggtccggctgtcggtcgggctggag
gatgtgcgggatatctgggccgatctgggtgcggccttggatgctgagttaggcactctg
tcgcacgcggcgtga

DBGET integrated database retrieval system