KEGG   Sphingomonas sp. LM7: BXU08_02065Help
Entry
BXU08_02065       CDS       T04824                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
splm  Sphingomonas sp. LM7
Brite
Enzymes [BR:splm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     BXU08_02065
Peptidases [BR:splm01002]
 Metallo Peptidases
  Family M2
   BXU08_02065
Exosome [BR:splm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BXU08_02065
CD molecules [BR:splm04090]
 Proteins
  BXU08_02065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: AQR75623
UniProt: A0A1S6FQ56
LinkDB All DBs
Position
425199..427031
Genome map
AA seq 610 aa AA seqDB search
MIRTGISMLALVAFQAVPAVAQTAPATTASATPTAAEAQAFLDRVQKEYTEFNLVASRVA
WINATYITDDTDALAADYGARGTEMAVGFALEAAKYQKAPGLTPEQQRQLTMIRSAITLP
APTTPGAAQQLSDISTKLGSLYGKGKGTRGGQPINGSDIEAAMSESRNPAELQEMWTSWN
DNVGAPMRGDYAKMTAIANQGATGLGFADTGTMWRSAYDMPPEEFAKLTDKLWADVKPLY
VALHTYVRRKLNEKYGDAVQSKTGPIRADLLGNMWAQEWGGIYDVVAPAGAGDLGYDVGE
LLKAKGQDWKKMVQTGEGFYSSLGLAPLPESFWQRSLFLKPADREVLCHASAWDVDEKDD
LRIKMCIKVNSDDFVTIHHELGHNYYQRAYKAQPQLYRNGANDGFHEAIGDFVALSITPD
YLVQIGLLDKAAVPGADKDTGLLLRQAMDKVAFLPFGLLVDKYRWQIFSGAIKPEGYQAG
WDKLRLDYQGLKPPVARDETRFDAGAKYHVAGSVPYTRYFLARLLQFQFYKAACDQAGWK
GPLHRCSFYGNKEVGARLNKMLEMGASKPWPDALEAFTGTREISGKAMAEYFAPLKKWLD
QQNKGQPQGW
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtaccggcatttcgatgctcgcgctcgtcgcgttccaggccgttcccgcagtt
gcgcagaccgcgccggcgaccactgcgtccgccacgcccaccgccgccgaggcgcaggca
ttcctcgaccgcgtccagaaggaatataccgagttcaacctcgtcgcctcgcgggtggcg
tggatcaatgcgacctatatcaccgacgataccgatgcgctcgcggcggactatggcgca
cgcggcaccgagatggcggtgggcttcgcgctcgaggcggcaaagtaccagaaggcgccc
gggctcacgcccgagcagcagcgtcagctcaccatgatccgcagcgcgatcaccttgccc
gcgccgaccacgccgggcgccgcgcagcagctctccgacatatctaccaagcttggctcg
ctctacggcaagggcaagggcacgcgcggcggccagccgatcaacggcagcgacatcgaa
gccgcgatgagcgagagccgcaatccggccgagctccaggagatgtggacgagctggaac
gacaatgtcggcgcgccgatgcgcggcgactatgccaagatgaccgcaatcgccaatcag
ggtgccaccgggctgggctttgccgatacgggcacgatgtggcgctcggcctatgacatg
ccgccggaagagttcgccaagctcaccgacaagctctgggcggacgtcaagccgctctat
gtcgcgctccacacctatgtacggcggaagctcaacgagaaatatggcgacgcggtccag
tccaagacgggacctatccgcgcggacctgctcggcaatatgtgggcgcaggaatggggc
ggcatctacgacgtcgtcgcgccggcgggcgcgggcgatctgggctatgacgtcggcgag
ttgctcaaggccaaggggcaggactggaagaagatggtgcagaccggcgagggcttctat
tcctcgctcggcctcgcgccgctcccggagagcttctggcagcgctcgctgttcctcaag
cccgccgaccgcgaagtgctgtgccacgcctcggcctgggacgtggacgagaaggacgac
ctgcgcatcaagatgtgcatcaaggtcaattccgacgacttcgtcacgatccaccacgag
ctcggccacaattactatcagcgcgcgtataaggcgcagccccagctctaccgcaacggc
gcgaacgacggcttccatgaggcgatcggcgatttcgtcgcgctctcgatcacgcccgac
tatctcgtccagatcggtctgctcgacaaggcggcggtgccgggtgccgacaaggacacc
gggctgctgctgcgccaggcgatggacaaggtggcgttcctgcccttcggcctgctggtc
gacaaatatcgctggcagatcttttccggggcgatcaagccggagggctatcaggccggt
tgggacaagctgcggctcgactatcaggggctcaagcccccggtcgcgcgcgacgagacc
cgcttcgacgcgggcgccaaataccatgtcgccggcagcgtgccctacacgcgctacttc
ctcgcgcggctgctccagttccagttctacaaggcggcatgtgaccaggccggctggaaa
ggcccgctgcatcgctgctccttctacggcaacaaggaagtcggcgcgcggctgaacaag
atgctcgagatgggcgcgtccaagccctggccggacgcgttggaggcattcaccggcacc
cgcgaaatctcgggcaaggcgatggccgaatatttcgcgccgctcaagaagtggctcgac
cagcagaacaagggccagccgcagggctggtga

DBGET integrated database retrieval system