KEGG   Sphingomonas sp. LM7: BXU08_11045Help
Entry
BXU08_11045       CDS       T04824                                 

Definition
(GenBank) phosphoribosyl-ATP diphosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
splm  Sphingomonas sp. LM7
Pathway
splm00340  Histidine metabolism
splm01100  Metabolic pathways
splm01110  Biosynthesis of secondary metabolites
splm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:splm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BXU08_11045
Enzymes [BR:splm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     BXU08_11045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG MazG-like
Motif
Other DBs
NCBI-ProteinID: AQR74117
UniProt: A0A1S6FKN1
LinkDB All DBs
Position
2389005..2389325
Genome map
AA seq 106 aa AA seqDB search
MADSLDALEAVIRERRAGDPDSSYVARLTARGRAKIAQKLGEEAVETVIAAIEDDKAGMV
SEAADLVFHLAILLADAGLSLDDVRAELARRQGVSGIDEKASRHAD
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggcagatagtctcgacgccctcgaagccgtgatccgcgaacgccgcgccggcgatccg
gatagctcctatgtcgccaggctgaccgcccgcggccgcgccaagatcgcccaaaagctc
ggcgaggaagccgtcgagacggtgatcgcggcgatcgaggacgacaaggccgggatggtc
agcgaagccgccgacctggtcttccatctcgccattctcctcgccgacgccgggctcagc
ctcgacgacgtccgcgccgaactcgcccgccgccaaggcgtgtcgggcatcgatgaaaag
gccagccgacatgccgattga

DBGET integrated database retrieval system