KEGG   Sphingomonas sp. LM7: BXU08_11315Help
Entry
BXU08_11315       CDS       T04824                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
splm  Sphingomonas sp. LM7
Pathway
splm00020  Citrate cycle (TCA cycle)
splm00190  Oxidative phosphorylation
splm00650  Butanoate metabolism
splm01100  Metabolic pathways
splm01110  Biosynthesis of secondary metabolites
splm01120  Microbial metabolism in diverse environments
splm01130  Biosynthesis of antibiotics
splm01200  Carbon metabolism
Module
splm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
splm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
splm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:splm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BXU08_11315
   00650 Butanoate metabolism
    BXU08_11315
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BXU08_11315
Enzymes [BR:splm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BXU08_11315
    1.3.5.4  fumarate reductase (quinol)
     BXU08_11315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 DAO DUF917
Motif
Other DBs
NCBI-ProteinID: AQR74159
UniProt: A0A1S6FKM7
LinkDB All DBs
Position
2445489..2447291
Genome map
AA seq 600 aa AA seqDB search
MPAAYKIIDHTYDAVVVGAGGSGLRATMGAAEAGLKTACITKVFPTRSHTVAAQGGIAAS
LGNNSPDHWSWHMFDTVKGSDWLGDQDAIEYMVREAPAAVYELEHAGVPFSRNDNGTIYQ
RPFGGHMQNMGEGPPVQRTCAAADRTGHAMLHALYQQSLKYDADFYVEYFALDLIMENGA
CRGVIALCMEDGSIHRFRSHSVVLATGGGGRVYQSATSAHTCTGDGNGMALRAGIALQDM
EFVQFHPTGIYGAGVLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVARSMAME
IREGRGVGKEKDHIFLHLNHIDPKILHERLPGITETGKIFAGVDLTRQPLPVVPTVHYNM
GGIPTNYHGEVVHNKDGNPDTVIPGLFAVGEAACVSVHGANRLGSNSLIDLVVFGRATGL
RLKEIVKPGTAHAALPANSEEFSLTRLDHFRNAKGAKPTAQIRADMQKTMQRHCAVFRDS
ALLAEGVTHMDAVYQSFQDVGISDRSLIWNTDLVETLELDNLIGQAVVTIQCAANRKESR
GAHMHEDFPDRNDAEWMKHTVATFEGWGGKQGGVAIDYRPVHDYTLTDEIEYIKPKKRVY
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgcgtacaagatcatcgatcacacctatgacgccgtcgtcgtcggcgccggc
ggttcgggcctgcgcgccaccatgggcgcggccgaagccggcctcaagacggcgtgcatc
accaaggtgttcccgacgcgcagccacaccgtggccgcacagggcggcatcgcggcatcg
ctcggcaacaatagccccgatcactggtcgtggcacatgttcgacaccgtcaagggctcc
gactggctcggcgaccaggacgcgatcgaatatatggtgcgcgaggcgcccgccgcggtc
tacgagctcgagcatgctggcgtgccgttcagccgcaacgacaacggcacgatctaccag
cgcccgttcggcggccacatgcagaatatgggtgaaggcccgccggtccagcgcacctgc
gccgccgccgaccgcaccggccacgcaatgctgcacgcgctctaccagcagagcctgaag
tacgacgccgacttctacgtcgaatatttcgcgctcgacctgatcatggagaacggcgcc
tgccgcggcgtgattgctttgtgcatggaagacggcagcatccaccgcttccgcagccat
tcggtcgtgctcgccaccggcggcggcggccgcgtctaccagtcggcaacctcggcacac
acctgcaccggcgacggcaacggcatggcgctgcgcgccggcatcgcactgcaggacatg
gagttcgtccagttccacccgaccggcatctacggcgccggcgtgctgatcaccgagggc
gcgcgcggcgaaggcggctatttgaccaactccgagggcgagcgcttcatggagcgctat
gcccctagcgcgaaggatctcgccagccgcgacgtcgtcgcccgctcgatggcgatggag
atccgcgagggccgcggcgtcggcaaggagaaggatcacattttccttcacctgaaccat
atcgacccgaagatcctgcacgagcggctgcccggcatcaccgagaccggcaagatcttc
gccggcgtcgacctcacccgccagccactgccggtggtaccgaccgtccattacaatatg
ggcggcatcccgaccaactatcacggcgaagtcgtccacaataaggacggcaatcccgac
accgtcatccccggcctgttcgcggtcggcgaggcggcatgcgtctcggttcacggcgcc
aaccgccttggctcgaactcgctgatcgatctcgtcgtgttcggccgcgccaccggcctg
cgcctcaaggaaatcgtcaagcccggcaccgcgcacgcggcgctgccggcaaattcggaa
gagttttcgctcacccgtctcgaccatttccgcaacgccaagggtgcgaagcccactgcg
cagattcgcgccgacatgcaaaagacgatgcagcgccactgcgccgtgttccgcgacagc
gcattgctcgccgaaggcgtcacccacatggacgccgtctatcagagcttccaggacgtc
ggcatctccgaccggtcgctgatctggaacaccgatctggtcgagacgctcgaactcgac
aatctgatcggccaggccgtggtgacgatccagtgcgccgccaaccggaaggaaagccgc
ggtgcacacatgcacgaggacttccccgatcggaacgacgccgagtggatgaagcacact
gttgcgacattcgaaggctggggcggcaagcagggcggcgtcgcgatcgactatcgcccg
gtgcacgactacacgctgacggacgagatcgagtatatcaagccgaagaagcgggtgtac
tga

DBGET integrated database retrieval system