KEGG   Sphingomonas sp. LM7: BXU08_12610Help
Entry
BXU08_12610       CDS       T04824                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
splm  Sphingomonas sp. LM7
Pathway
splm00061  Fatty acid biosynthesis
splm00780  Biotin metabolism
splm01100  Metabolic pathways
splm01130  Biosynthesis of antibiotics
splm01212  Fatty acid metabolism
Module
splm_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:splm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BXU08_12610
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BXU08_12610
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BXU08_12610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:splm01004]
    BXU08_12610
Enzymes [BR:splm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BXU08_12610
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BXU08_12610
Lipid biosynthesis proteins [BR:splm01004]
 Fatty acid synthase
  Component type
   BXU08_12610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AQR74381
UniProt: A0A1S6FL43
LinkDB All DBs
Position
complement(2733547..2734350)
Genome map
AA seq 267 aa AA seqDB search
MTGLMQGKRGLIMGLANDRSLAWGIAQKLREHGAELAFSYQGEALEKRVRPLAEHLGQDF
LIECDVSDMADLDRAFATLAERWPTIDFVVHAIGFSDKNELRGGYVDTSLDNFLMTMNIS
VYSFVAVAQRASKMMPNGGSLLTLSYYGAEKVIPHYNVMGVAKAALETSVQYLAVDLGRD
NIRVNAISAGPIKTLAASGIGDFRLILKWNELNSPLKRNVTIEDVGGAGLYLLSDLASGV
TGETHHVDAGYNVIGMKAEDAPDIALV
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggattgatgcagggcaagcgcgggctgatcatgggcctggcgaacgatcgttcg
ctggcatggggcattgcccagaagctgcgcgagcatggcgccgaactggcgttcagctat
cagggcgaggcgctggaaaagcgcgtgcggccgctcgccgagcatctcggccaggacttc
ctgatcgaatgcgacgtctcggacatggccgatctcgacagggccttcgcgacgctcgcc
gagcgctggccgacgatcgacttcgtcgtccacgcgatcggcttctcggacaagaacgag
ctgcgcggcggctatgtcgacaccagcctcgacaatttcctgatgacgatgaacatcagc
gtctattcgttcgtcgcggtggcgcagcgcgcgtcgaagatgatgccgaacggcggcagt
ctgctgacgctcagctattacggcgccgagaaggtgatcccgcattataacgtgatgggc
gtcgccaaggctgcgctggaaaccagcgtccagtatctcgccgtcgatctgggccgcgac
aatatccgcgtcaacgcgatctcggccgggccgatcaagacgctggcggcaagcgggatc
ggcgacttccgcctgatcctcaagtggaacgaactcaattcgccgctcaagcgcaacgtg
acgatcgaggatgtcggaggcgccgggctatacctgctgtccgacctggcctcgggtgtg
accggcgagacccaccatgtcgacgccggctacaacgtcatcggcatgaaggccgaggac
gcgcccgacatcgcattggtgtga

DBGET integrated database retrieval system