KEGG   Sphingomonas sp. LM7: BXU08_13665Help
Entry
BXU08_13665       CDS       T04824                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
splm  Sphingomonas sp. LM7
Pathway
splm00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:splm00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BXU08_13665
Enzymes [BR:splm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BXU08_13665
Transporters [BR:splm02000]
 Other Transporters
  Pores ion channels [TC:1]
   BXU08_13665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AQR74553
UniProt: A0A1S6FM31
LinkDB All DBs
Position
2964617..2965288
Genome map
AA seq 223 aa AA seqDB search
MWQLLQFPLCPFSRKVRLLLGEKAIGYEPVRESPWQRRDEFLDLNPTGQVPVMVDTERGV
TLIDSTVICEFFEETVSKNAMINGTATDRAEIRRLVIWFDDHFYGDITAPLLHERMIKRV
VHKVAPDAKALREAMKAAVAHLDYIDYLLDHRTWLAGPTMSLADLAAAAQISIADYLGGI
DWKSHDQAKRWYIGMKSRPSFRPLLSERMEGIPPPADYEKLDL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagctccttcaattcccgctctgtccgttttcgcgcaaggtccgcctgctgctg
ggcgagaaggccattggctatgagccggtgcgcgaatcgccctggcagcgccgcgacgag
ttcctcgacctgaaccccaccgggcaggttccggtgatggtcgataccgagcgcggcgtg
acgctgatcgattcgacggtgatctgcgagttctttgaggagacggtcagcaagaacgcg
atgatcaacggcaccgccaccgaccgcgccgagatccgccggctcgtgatttggttcgac
gatcatttctatggggacatcactgccccgctgctccacgagcggatgatcaagcgcgtg
gtgcacaaggtcgcgcccgacgccaaggcactgcgggaggcgatgaaggccgcagtcgcg
catctcgattacatcgattacctgctcgatcaccgcacctggctcgccggcccgacgatg
agcctcgccgatctggccgcggcggcgcaaatctcgatcgccgactatctcggcgggatc
gactggaagagccacgaccaggccaagcgctggtatatcggcatgaagagccgcccgagc
ttccggccgttgctgtccgagcggatggaggggatcccaccgcctgcggattacgaaaag
ctcgacctgtag

DBGET integrated database retrieval system