KEGG   Streptomyces pluripotens: LK06_002025Help
Entry
LK06_002025       CDS       T04845                                 

Definition
(GenBank) hypothetical protein
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
splu  Streptomyces pluripotens
Brite
KEGG Orthology (KO) [BR:splu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LK06_002025
Enzymes [BR:splu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LK06_002025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ARP68929
UniProt: A0A221NTC3
LinkDB All DBs
Position
484636..485916
Genome map
AA seq 426 aa AA seqDB search
MTSTASSAGSARPDAVARPPVPCVQPLPQPLYATCPNDISFPWRHPVSWKSSRSHLPTTV
GAVTAALLTLASPAQAASAGDHTDTLAALRTFQAAAGPGAGVYAGDSAGSWNLSTGTGVI
NTHTPIAPSDHYRIGSQTKTFTAAVVLQLVDEGRVLLDAPIERYLPGVVDGNGYDGNAIT
VRQLLQHTSGIAAYEPLTDAPAANPDGSYSLGALVQQGLKHAPASKPGTAFLYSNTNYLI
LGLLIEKTTGLPVHQAVTDRIIKPLDLTRTSFPAPGDRSLPAPAVHGYNGIRIGSFYFWH
DVIGYDPSLFSSAGAMISSQQDLTTFYQALTAGKVVTPATLAEMENTDTVGAPGSPLAYG
LGLLRHNLPCGGVAWGHDGAIPGYYTETLVTTDGRHASVVTNAYLATNPPVQQMYSLLDT
ALCEKP
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgacggcgtcatcggccggctccgcaaggcctgatgccgtcgctcgtccgccc
gtaccttgcgtgcaaccgcttccgcagcccctttacgccacctgtcccaacgacatctcg
tttccctggaggcatcccgtgtcatggaagtccagcaggtcgcacctgccgaccaccgtc
ggtgccgtcacggcggcactgctcaccctcgcttcgccggcccaggcggcctcggccggc
gaccacaccgacacgctggcggcgttgcggacgttccaagcagcggcgggcccgggtgcg
ggcgtctacgccggtgacagtgcggggtcctggaacctctccaccggtacgggcgtcatc
aacacccacacgcccatcgcaccgagcgaccactaccgcatcggcagccagaccaagacg
ttcaccgcagcggtggtgctccaactggtcgacgagggcagggtcttgctcgacgcaccg
atcgagcggtacctgccgggcgtcgtcgacggcaacggctacgacggcaacgccatcacg
gtgcgccaactcctgcagcacaccagtggcatcgcggcctacgaaccgctcaccgacgcg
cccgccgccaaccccgacggctcctactcactgggcgcgctggtgcagcagggcctcaag
cacgcaccggcctccaagcccggcaccgccttcctctactccaacaccaactacctgatc
ctcggcctgctcatcgagaagaccaccgggcttccggtgcaccaagccgtcacggaccgg
atcatcaagccgctggacctgacccggaccagcttcccggcaccgggcgaccgctcctta
cccgctccggccgtgcacggctacaacggcatccggatcggcagcttctacttctggcac
gacgtgatcggctacgacccgtcactcttcagcagcgccggggccatgatctcgtcacaa
caggatctgaccaccttctaccaggcgctcaccgcagggaaggtggtcaccccggccacg
ctggccgagatggagaacaccgacaccgtcggcgcccccggatcacccctcgcctacgga
ctcgggctactgcggcacaacctgccctgcggcggtgtggcctggggccacgacggtgcg
atccccggctactacaccgagaccctggtcaccacggacggccggcacgcgtccgtggtg
accaacgcctacctcgcgaccaacccgccggtccagcagatgtacagcctgctggacacg
gcactgtgcgagaagccctga

DBGET integrated database retrieval system